KEGG   Chlamydia psittaci GR9: B598_0915Help
Entry
B598_0915         CDS       T02309                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
cpsg  Chlamydia psittaci GR9
Pathway
cpsg00471  D-Glutamine and D-glutamate metabolism
cpsg00550  Peptidoglycan biosynthesis
cpsg01100  Metabolic pathways
cpsg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cpsg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    B598_0915 (murC)
   00473 D-Alanine metabolism
    B598_0915 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B598_0915 (murC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    B598_0915 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cpsg01011]
    B598_0915 (murC)
Enzymes [BR:cpsg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B598_0915 (murC)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     B598_0915 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:cpsg01011]
 Precursor biosynthesis
  Amino acid ligase
   B598_0915 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N Mur_ligase Mur_ligase_M Mur_ligase_C CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFS20986
LinkDB All DBs
Position
complement(959796..962228)
Genome map
AA seq 810 aa AA seqDB search
MDRKIHYHFIGIGGIGMSALAHILLDRGYSVSGSDLNRGAIIDKLVAKGARYLQGHDKHH
IPEDCTIIYGSGIAKDNVEYLEAVRKQLPILHRSELLAFLMQEQTSILVSGSHGKTTVSS
LITAIFQTAKKDPSYAIGGLNSLSLNGYSGSSEYFIAEADESDGSLKHYLPKVAVVTNLD
NEHLSNFEGSKEKLALTIEEFTRKVEDPRLCFYNGDCQELKGRISGTSYGFSQDCNLRIH
SYYQDGWRSLFSLSFLGKDYLDIDLNLIGKHNIANAAVAMGIALTLGIDEESIREALKNF
SGIQRRMERKNVSEKFLFFEDYAHHPSEISCTLRGLRDAVGLRRIVAICQPHRFSRLQYC
LEDFYKAFQDADEVILTDVYSAGETALDLPSPEKLAETISLSSHVQCSYVPYDNIIPYLQ
QEIRVHDVCISLGAGNIYTVGNALKDFEPRKLAVGVVCGGKSCEHDISLLSARNVVRYLS
PEYYDVQYFIIDRQGLWSKVSTIECEDYEGKGHYVLSSEITEALTHVDFILPILHGPFGE
DGTLQGFLEIINKPYAGPSLLFSSVTMDKIMTKRLAASVGVPVVPYQPLTLHAWKRTPEL
CMHKISEAFTFPMFVKTAHLGSSIGVFEVHNEEELKAKISEAFLYDTDIFIEESRLGSRE
IEVSCLGDSSSCYYISEPHERCGEKRFISYEEKYGLNGRASAQIQYDLDLSEESKIRVKE
FTERVYRVIQGQGSCRVDFFLDDEGNFWLSEMNPIPGMTQASPFLHDFARLGWTFEQIIH
QLIISGLHKFDRKKKVGKTLNKQCLLTAKS
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atggataggaaaatccactatcattttataggtatcggcggaataggaatgagtgcacta
gctcatattttattagaccggggatattccgtatcaggaagtgatttaaatcgaggagcc
attatcgataagcttgtggccaaaggggcacggtatttacaagggcatgataaacatcat
attcctgaagattgcactatcatctatggatcagggatcgctaaggataacgtagaatat
ctagaagctgtaaggaaacagttacccatactccatcgttctgaacttctcgcttttttg
atgcaagaacaaacaagtattttagtttcagggagtcatggcaaaacgacagtatcttcg
ttaatcaccgccattttccaaacagcaaaaaaagatccttcctatgctattggaggtctg
aattctctatctttgaatggttattcaggaagctcagagtactttatagcggaagctgat
gaaagcgacggctctttaaaacactatcttcctaaagttgctgttgtaaccaatttagat
aatgaacatctcagtaattttgaagggagtaaggagaaacttgctttaacaattgaagaa
ttcactcgtaaggttgaagatccgcgtttatgtttttataatggcgattgccaagaactt
aaaggaagaatctcaggaacatcttatggattttctcaagattgtaacttacgtatacat
tcctattatcaagatggctggcgctcgctattttctctgtctttcttagggaaagattac
ttggacatagatcttaaccttatcggtaagcacaacattgcaaacgctgctgtagctatg
ggtatagcattaactttgggtattgatgaggaaagtattcgagaggctcttaagaacttt
tctggtattcaaagacgtatggaaagaaagaatgtttcagagaaattcttattctttgaa
gactatgcacaccatccttctgagatctcttgcactctaagaggattacgagatgctgtt
ggcttgcgtcgtatagttgcgatatgtcaaccacatagattttctagattgcaatattgt
ctggaagatttttataaagcttttcaagatgctgatgaggtgattctcactgatgtctac
agtgctggagaaactgcattagatttaccgtctcctgagaaattagcagagacgatttcc
ttatcctctcatgtacaatgtagctatgttccttatgacaacattatcccatacctgcaa
caagaaatacgcgttcatgatgtgtgtatatctttaggagctggaaatatttataccgta
ggcaatgctttaaaggattttgaacctaggaagctcgcagttggagttgtctgtggaggg
aagtcttgcgaacacgatatttctttgttgtctgcgagaaatgtcgttcggtatttgtct
cctgaatactacgatgtgcaatactttattatcgatcgccagggattatggtcaaaagtc
tccactattgaatgtgaagattatgaagggaaaggtcattacgtcttgtcttcagagata
acagaggctcttacacatgtagattttatccttccgatattacatggcccttttggagag
gacggtacgcttcagggatttttagaaattatcaataagccctatgctggaccctctctg
ctcttttcctcagtcactatggataagattatgacaaaacgccttgcagcttctgtaggt
gttcccgtggttccttatcagccattgactttacatgcttggaaaagaactccagagtta
tgtatgcataagatttcagaggcctttacttttcctatgtttgtgaaaactgcacatttg
ggatcgagtattggggtttttgaagtgcataatgaagaagaactaaaagcaaaaatatct
gaagctttcctatatgatacagatatttttatcgaagaaagtcgtttaggatctcgcgaa
attgaagtgtcttgtctcggagactccagtagctgttactatatttctgaaccacatgaa
cgttgtggtgagaaaagatttattagttatgaagagaaatatggattaaacggtagagca
agcgctcaaatacaatacgatttggatctctccgaagaatctaaaataagagtaaaggag
ttcacagaacgtgtgtaccgtgtgattcaaggacaaggttcatgtagagtcgatttcttt
ttagatgatgaaggaaatttttggctttctgaaatgaaccctattccaggaatgacacag
gcaagtccttttcttcatgattttgcccgtttaggatggacttttgaacaaatcattcat
caattgattatatcagggctacataagtttgatcggaagaaaaaggtcggaaagactttg
aataagcagtgtctattaactgcgaagagctaa

DBGET integrated database retrieval system