KEGG   Chlamydia psittaci MN: B599_0047Help
Entry
B599_0047         CDS       T02311                                 

Definition
(GenBank) kinase domain protein
Organism
cpsi  Chlamydia psittaci MN
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo APH Kinase-like Haspin_kinase SpoIIE Seadorna_VP7 Choline_kinase
Motif
Other DBs
NCBI-ProteinID: AFS21794
LinkDB All DBs
Position
48066..49484
Genome map
AA seq 472 aa AA seqDB search
MYQGLHSETLQSAAIKVLEPPLVADTRRVHNFLKEARIIEQVSHPHIVKLYQYGQCREGL
YIAMEYIQGVSLRQYILTHLIPLSKAIDIVLHIGQAIEYLHSRGILHRDIKPENILINSQ
GQIKLIDFGLAVCSSTEHASHPACLGTPSYMSPEQRQGDKVSEKSEIYSLGLIAYELISG
NLALGKVILSLIPDRVSKILAKALQPSPKDRYGSMKEFMSHLHRYRYSQDLQKDYRNKDY
TAQVNEQLYQQRFWLSPTEIVVPDFLSVSIYEQGYPTHPHVYYEAYMSQDTFRLWFCYSL
SGNATLVLTIIKTFVSQWGHEDNIRSTMRKMHSELMRINVPIDTTEISLVCVTIPKEKKE
LSWITCGKTSFWLKKQGKVPQNFTTSSLGLGKISSLQIQETKVAWEIGDGAVLHTLPADD
SMSSLNSPLFTELKDRGQTAIFCPIESVQFGILENHDGNLCPSTLISLKRIR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgtaccagggtttgcattctgaaactctacaatctgcagctattaaagtgcttgaaccg
cctttagttgctgatacgcgcagagttcataactttttaaaagaagcacgaattattgaa
caagtctcacatccccatattgttaagttatatcaatatggacagtgtagagaaggtctg
tatatagccatggaatatatacaaggcgtgtctcttagacagtatatcctcacccatcta
attcctttatccaaggctattgatatagtgttacatattggccaggctatagaatatctg
catagccgtggtatactccatagggatatcaaacccgaaaatatcctgattaattctcaa
gggcaaatcaaactcatagattttggacttgctgtttgttcttctacagaacatgcttct
catcctgcttgtttaggaacgccttcatatatgagccctgaacaacgtcaaggagataaa
gtttctgaaaaatcagaaatctactctctaggtttaattgcttatgaattgatctcggga
aacctagctctaggtaaggtcattttatcattgattccggatagagtgagtaagatttta
gcgaaggccttgcaaccttctcctaaagatcgttacggatctatgaaagaattcatgagt
catttacatcgatatcggtacagccaagaccttcagaaagattatcgtaataaagattat
acagcacaggttaatgagcagctgtatcagcagagattttggttatctcctacagaaatt
gttgtccccgacttcttatccgtttctatatatgagcaaggatacccaacacatcctcat
gtatactacgaagcttatatgagtcaggatactttccggttgtggttttgttatagtctt
tcaggaaatgcaactttagtattaactattataaaaaccttcgtaagtcagtggggccat
gaagataacattagaagtacgatgcgaaaaatgcatagtgagctaatgcggatcaatgtt
cctattgatacaacggaaatttctttagtttgcgttactattcccaaagaaaaaaaggaa
ctttcttggattacttgtgggaaaactagtttctggttaaaaaaacaaggaaaggttcct
cagaattttactacttcatccttaggtttagggaaaattagttctttacaaattcaggaa
accaaggttgcatgggaaataggtgatggagcagtattacataccttaccggcagacgat
tccatgtcatctttaaatagtcctttattcacagagttgaaagatagaggacaaacagct
atattctgcccaatagagagcgtacagttcgggatattagaaaatcatgacggaaatctt
tgtccctcaacacttatcagcttaaaaagaatccggtga

DBGET integrated database retrieval system