KEGG   Chlamydia psittaci NJ1: B712_0045Help
Entry
B712_0045         CDS       T02252                                 

Definition
(GenBank) kinase domain protein
Organism
cpsn  Chlamydia psittaci NJ1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Kdo Kinase-like Haspin_kinase SpoIIE Seadorna_VP7 WaaY Choline_kinase ATP-gua_Ptrans
Motif
Other DBs
NCBI-ProteinID: AFS27578
LinkDB All DBs
Position
48071..49489
Genome map
AA seq 472 aa AA seqDB search
MYQGLHSETLQSAAIKVLEPPLVADTRRVHNFLKEARIIEQVSHPHIVKLYQYGQCREGL
YIAMEYIQGVSLRQYILTHLIPLSKAIDIVLHIGQAIEYLHSRGILHRDIKPENILINSQ
GQIKIIDFGLAVCSSTEHASHPACLGTPSYMSPEQRQGDKVSEKSEIYSLGLIAYELISG
NLALGKVILSLIPDRVSKILAKALQPSPKDRYGSMKEFMSHLYRYRYSQDLQKDYRNKDY
TAQVNEQLYQQRFWLSPTEIVVPDFLSASIYEQGYPTHPHVYYEAYMSQDTFRLWFCYSL
SGNATLVLTIIKTFVSQWGHEDNIRSTMRKMHSELMRINVPIDTTEISLVCVTIPKEKKE
LSWITCGKTSFWLKKQGKVPQNFTTSSLGLGKISSLQIQETKVAWEIGDGAVLHTLQADD
SMSSLNSPLFTELKDRGQTAIFCPIESVQFGILENHDGNLCPSTLISLKRIR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgtaccagggtttgcattctgaaactctacaatctgcagctattaaagtgcttgaaccg
cctttagttgctgatactcgcagagttcataactttttaaaagaagcacgaattattgaa
caagtctcacatccccatattgttaagttatatcaatatggacagtgtagagaaggtctg
tatatagccatggaatatatacaaggcgtgtctcttagacagtatatcctcacccatcta
attcctttatccaaggctattgatatagtgttacatattggccaagctatagaatatctg
catagccgtggtatactccatagggatatcaaacccgaaaatatcctgattaattctcaa
gggcaaatcaaaatcatagattttggacttgctgtttgttcttctacagaacatgcttct
catcctgcttgtttaggaacgccttcatatatgagccctgaacaacgtcaaggagataaa
gtttctgaaaaatcagaaatctactctctaggtttaattgcttatgaattgatctcggga
aacctagctctaggtaaggtcattttatcattgattccggatagagtgagtaagatttta
gcgaaggccttgcaaccttctcctaaagatcgttacggatctatgaaagaattcatgagt
catttatatcgatatcggtacagccaagaccttcagaaagattatcgtaataaagattat
acagcacaggttaatgagcagctatatcagcagagattttggttatctcctacagaaatt
gttgtccccgacttcttatccgcttctatatatgagcaaggatacccaacacatcctcat
gtatactacgaagcttatatgagtcaggatactttccggttgtggttttgttatagtctt
tcaggaaatgcaactttagtattaactattataaaaaccttcgtaagtcagtggggccat
gaagataacattagaagtacgatgcgaaaaatgcatagtgagctaatgcggatcaatgtt
cctattgatacaacggaaatttctttagtttgcgttactattcccaaagaaaaaaaggaa
ctttcttggattacttgtgggaaaactagtttctggttaaaaaaacaaggaaaggttcct
cagaattttactacttcatccttaggtttagggaaaattagttctttacaaattcaggaa
accaaggttgcatgggaaataggtgatggagcagtattacataccttacaggcagacgat
tccatgtcatctttaaatagtcctttattcacagagttgaaagatagaggacaaacagct
atattctgcccaatagagagcgtacagttcgggatattagaaaatcatgacggaaatctt
tgtccctcaacacttatcagcttaaaaagaatccggtga

DBGET integrated database retrieval system