KEGG   Corynebacterium pseudotuberculosis CS_10: CPTB_00757Help
Entry
CPTB_00757        CDS       T03483                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cpsu  Corynebacterium pseudotuberculosis CS_10
Pathway
cpsu00020  Citrate cycle (TCA cycle)
cpsu00190  Oxidative phosphorylation
cpsu00650  Butanoate metabolism
cpsu01100  Metabolic pathways
cpsu01110  Biosynthesis of secondary metabolites
cpsu01120  Microbial metabolism in diverse environments
cpsu01130  Biosynthesis of antibiotics
cpsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPTB_00757
   00650 Butanoate metabolism
    CPTB_00757
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CPTB_00757
Enzymes [BR:cpsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CPTB_00757
    1.3.5.4  fumarate reductase (quinol)
     CPTB_00757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_10 Fer4_8 Fer4_17 Fer4_9 Fer4 Fer4_16 Fer4_18 Fer4_4 Fer4_2 Fer4_6 Fer4_21 Fer4_15 Fer4_3 Fer2 Fer4_22 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AIG08813
UniProt: A0A1L6CY37
LinkDB All DBs
Position
complement(782265..783014)
Genome map
AA seq 249 aa AA seqDB search
MKLHLEIWRQAGPHSEGHFESIDVEDAVAQMSILELLDHVNTGLVEEGKEPFVFASDCRE
GICGTCGLLVNGRPHGLDKNKPSCQQRLDHVADGSTLKIEPFRSAAYPVIKDLAVDRSAL
DRVMQKGGYVSINAGTAPDADTIYQNHEKAELALDHAACIGCGACVAACPNGAAHLFTGA
KLVHLALMPLGREERGKRARNMIDELETNFGHCSLYGECADVCPAGIPLSAVAAINKERA
RAFFRGKDD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccatcttgaaatttggcgtcaggccggtcctcacagcgaaggtcatttcgag
tccatcgacgtcgaggacgccgtagcgcagatgtctatccttgagctgctggaccacgtc
aacactggcctggttgaggagggcaaagagccctttgtctttgcttcggactgtcgtgaa
ggcatctgtggcacctgtggcctgttggttaacggacgtccgcatggcctggacaagaac
aagccttcctgccagcagcgccttgatcacgtggcagatggttcgaccctcaagatcgag
cctttccgttctgctgcttacccagtgatcaaggacctcgctgttgatcgctcggctctt
gaccgagtgatgcaaaagggtggctacgtttcaatcaatgccggcacggctccggacgca
gacaccatttaccagaaccacgagaaagctgagcttgctcttgaccatgctgcatgcatc
ggttgtggcgcctgtgtagctgcgtgccccaacggtgcagcgcacctgttcacgggagca
aagcttgtgcatctcgctcttatgcctttgggtcgtgaagagcgtggcaagcgtgcccgc
aatatgattgatgagcttgagaccaactttggtcactgctcgctgtatggcgagtgcgca
gatgtctgcccggcaggcattccgctttccgccgtcgcagctatcaacaaagagcgggcc
cgcgctttcttccgtggtaaggacgactaa

DBGET integrated database retrieval system