KEGG   Corynebacterium pseudotuberculosis CS_10: CPTB_00758Help
Entry
CPTB_00758        CDS       T03483                                 

Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cpsu  Corynebacterium pseudotuberculosis CS_10
Pathway
cpsu00020  Citrate cycle (TCA cycle)
cpsu00190  Oxidative phosphorylation
cpsu00650  Butanoate metabolism
cpsu01100  Metabolic pathways
cpsu01110  Biosynthesis of secondary metabolites
cpsu01120  Microbial metabolism in diverse environments
cpsu01130  Biosynthesis of antibiotics
cpsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPTB_00758
   00650 Butanoate metabolism
    CPTB_00758
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CPTB_00758
Enzymes [BR:cpsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CPTB_00758
    1.3.5.4  fumarate reductase (quinol)
     CPTB_00758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA NAD_binding_8 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AIG08814
LinkDB All DBs
Position
complement(783014..785029)
Genome map
AA seq 671 aa AA seqDB search
MSFNSETATRPEFTQPASIVDGVKLGSILESNEPKGVPTKDMWEYQKDHMNLVSPLNRRK
FTVLVVGTGLSGGGAAAALGELGYNVKVFTYHDAPRRAHSIAAQGGVNSARGKKVDNDGA
YRHVKDTVKGGDYRCRESDCWRLAYESVRVIDHMNAIGAPFAREYGGTLATRSFGGVQVS
RTYYTRGQTGQQLQLSGAAALQRQIGLGTVEIFTHADMHDLILTDENGKKACRGIVTRNL
ITGELTPHTGHAVILATGGYGNVYHMSTLAKNSNASAMMRAYELGAYLASPSFIQFHPTG
LPVNSEWQSKTILMSESLRNDGRIWSPLEPKDDRDPNTIPEEERDYFLERRYPAFGNLVP
RDVASRAISQQINKGLGVGPLHNSAYLDFRDSIERLGENTIRERYSNLFQMYEEAIGENP
FKAPMRIAPTCHFTMGGLWTDFNEMTSIDGLFAAGECSWTYHGANRLGANSLLSASVDGW
FTLPFTIPNYLANHLGEAKLAEDAPEAVAAVARAQARIDKLMNIKGDDPHGPEHYHRQLG
DILYFSCGVARNVEDLKTGIEKIRKLRKEFWSNLRITGEAEEMNQVLEYACRVADYIDLG
ELMCVDALDRDESCGAHFREDHLSSEGEAERDDENWCFVSAWEPGAQEHEFIRHAEPLTF
ESIPLMTRNYK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaactctgaaaccgctactcgccctgagttcacccagccagcttccatcgtc
gatggcgtaaagctgggcagcatccttgaatccaacgagcccaagggcgttcctaccaag
gacatgtgggagtaccaaaaagaccacatgaacctggtttccccactgaaccgtcgtaag
tttacggtccttgttgtgggaaccggactttccggtggcggcgctgctgctgccctcggt
gaactgggatacaacgtgaaggtcttcacgtaccatgacgctcctcgtcgtgcgcactcc
attgctgcgcagggtggtgtgaactccgctcgcggtaagaaagtggacaacgacggtgct
taccgccacgtgaaggacactgtgaaggggggcgactaccgctgccgcgagtccgattgt
tggcgcttagcgtatgaatccgtacgcgtcatcgaccacatgaacgccattggtgctcct
ttcgctcgcgaatacggtggaaccttggctactcgttccttcggtggcgtgcaggtttcc
cgtacgtattacacgcgtggtcaaacaggccagcagctgcaattgtccggtgctgcagca
ttgcagcgtcagattggcctcgggactgtggagatctttacgcatgcagacatgcatgat
ctgatccttacagatgaaaacggcaagaaagcctgccgcggtattgtcacccgtaacctg
atcacaggcgagctcactcctcatacgggccatgcagtcatcctggctactggcggttac
ggcaacgtctatcacatgtctacgctggctaagaactccaacgcatcggcaatgatgagg
gcgtatgagctcggcgcttatttggcttctccgtctttcattcagttccacccgacaggc
cttccggttaactcggaatggcagtcgaagacgatcctgatgtccgagtctttgcgtaac
gacggccgcatctggtccccactcgagcccaaagacgatcgcgatcccaacacgatccct
gaagaagagcgcgactacttccttgagcgccgctacccggcattcggtaatctcgtgcct
cgcgacgtagcatcgcgtgctatttctcagcagatcaacaagggactcggcgttgggcct
ctgcacaactccgcttacctggacttccgcgattccattgagcgtcttggtgagaacaca
atccgtgagcgttattccaacctcttccagatgtatgaagaggcaattggtgagaaccca
ttcaaggctccgatgcgtattgccccgacttgccacttcaccatgggcggcttgtggacg
gactttaatgagatgacctctatcgacggtctctttgccgcaggtgagtgctcctggacc
tatcacggtgcaaaccgtctgggcgctaactccctgctttctgcctctgtcgatggctgg
tttaccttgccgtttactattccgaactacttggctaaccaccttggagaggccaagcta
gctgaggatgctcctgaagcagttgctgccgtggcacgagctcaggctcgcatagacaag
ctcatgaacattaagggcgatgatcctcatggtcctgagcattatcaccgccagctgggc
gatatcctctacttctcttgtggcgttgcccgtaacgttgaagatctgaagaccggtatt
gagaagattcggaaactccgtaaggaattctggtccaacctccgcattaccggtgaggca
gaagagatgaaccaggttcttgagtacgcatgccgcgtagctgactacatcgacctcggc
gagctcatgtgcgttgacgcgctcgaccgcgatgagtcctgtggtgcgcacttccgtgaa
gatcatctctcttctgagggtgaggcagagcgtgacgacgaaaactggtgctttgtttcc
gcttgggagccaggcgcacaggaacacgagttcattcgccatgctgagccactcacattc
gaatcgatcccgctgatgacaaggaactacaagtaa

DBGET integrated database retrieval system