KEGG   Chlamydia psittaci WC: B603_0428Help
Entry
B603_0428         CDS       T02313                                 

Definition
(GenBank) enoyl-acyl carrier reductase domain protein
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cpsw  Chlamydia psittaci WC
Pathway
cpsw00061  Fatty acid biosynthesis
cpsw00780  Biotin metabolism
cpsw01100  Metabolic pathways
cpsw01130  Biosynthesis of antibiotics
cpsw01212  Fatty acid metabolism
Module
cpsw_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cpsw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    B603_0428
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    B603_0428
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    B603_0428
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cpsw01004]
    B603_0428
Enzymes [BR:cpsw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     B603_0428
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     B603_0428
Lipid biosynthesis proteins [BR:cpsw01004]
 Fatty acid synthase
  Component type
   B603_0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: AFS25706
LinkDB All DBs
Position
complement(437238..438137)
Genome map
AA seq 299 aa AA seqDB search
MLKIDLTGKVAFIAGIGDDQGYGWGIAKALAEAGATIIVGTWVPIYKIFTQSWDLGKFNQ
SRKLSDGNLLEIKKIYPMDASFDKPEDVPEDVAESKRYKGMSGYTISEVVEHITKDFGHI
DILVHSLANSPEISKPLLETSRKGYLAALSSSSYSLVSLLAHFGPIMPRGSTSISLTYLA
SSRAVPGYGGGMNAAKAALESDTKLLAWEAGRKWGVRVNTISAGPLASRAGKAIGFIEKM
VDYYLEWTPIPEPMTTEHVGAVAAFLASPLASAITGETLYVDHGASIMGVGPEMLPKHS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaatcgatttaactgggaaagtggcttttatagcggggattggtgacgatcaa
ggttatggctggggaatcgctaaggcactagcagaagcaggagccactattatcgtagga
acctgggtacccatctataaaatcttcacgcagtcttgggatttagggaaatttaatcag
tctagaaagttatctgatggcaacctcttagaaattaaaaaaatttatcctatggacgca
agttttgataaacctgaagatgttcctgaagacgttgcagaaagtaaacgttataaaggt
atgtcaggatatactatctcagaggttgttgaacacattactaaagatttcggtcatatt
gatattttagtccactccctagcaaacagcccggaaatttccaaaccacttttagaaaca
tcacgtaaaggctatttagctgcattaagctcatcaagttattcgttagtgagtttatta
gctcactttggacctattatgcctcgaggaagcacaagtatttctttaacttacctagct
tcttctcgagcagttccaggatatggtggaggaatgaacgcagcaaaagctgctttagaa
agtgatacaaaactgctcgcttgggaagcaggaagaaaatggggcgtccgtgtaaacact
atttcggcaggtcctctagccagtcgcgcaggaaaagctattggatttatcgaaaaaatg
gtcgattactatttagaatggacccctattcctgaacctatgacaacagaacatgtggga
gccgttgctgctttcctagcttctccgttagctagcgcaattaccggagaaactctctat
gtagatcatggagcaagtatcatgggagttggtcctgaaatgcttcctaagcattcttaa

DBGET integrated database retrieval system