KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_01107Help
Entry
cpfrc_01107       CDS       T01277                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
cpu00620  Pyruvate metabolism
cpu00680  Methane metabolism
cpu01100  Metabolic pathways
cpu01120  Microbial metabolism in diverse environments
cpu01200  Carbon metabolism
Module
cpu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cpu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    cpfrc_01107 (ppc)
  Energy metabolism
   00680 Methane metabolism
    cpfrc_01107 (ppc)
Enzymes [BR:cpu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     cpfrc_01107 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADK28900
LinkDB All DBs
Position
complement(1204950..1207769)
Genome map
AA seq 939 aa AA seqDB search
MSVKATSAGPLSEQLVEDIRFLGALLGEVIKEQEGIAAFDRVEAARQLAFKISRKESQVE
DLVALLKDISAADAIPIIRAFSHFALLANMVEDLHDELGRLQRQEAGEQDPDSTLGATWK
KLANAGITNEKVSSLLSNFQVAPVLTAHPTETRRRTIFDAQEHMTTLLKKRHAILSSETN
ALTTARLEENTRHIRRWLTLIWQTALIRVARPRIEDEVEVGLRYYELSLLTAIPEINKQV
ADHIQREYGVNSEDALQSLLIKPGSWIGGDHDGNPYVTAGTLHYATTRAAETVLKFYVRE
LHQLEHELSLSDRLTDVSPDLRKLADLGHNDVPSRVDEPYRRAVHGVRGRVLATLASRIG
PETVEGSWYSRHAAYTAPEQLAADLDIIDASLRRTHDELIADDRLLRIRTAVSSFGFHLY
SMDLRQNSESYEDVLTELFERAQVTPHYRKLDESEKISVLIAELSSPRPLIPRDGLPYSE
LTQRELDIIFEAKQAVDAFGTMMIPHSIISMAESASDILEPMVLLKEFGLIKIQEGHLTG
HIDVIPLFETIDDLQNGAKILQDLWQIPLYRSYLEQRGNLQEVMLGYSDSNKDGGYLAAN
WALYAAETDLVNICKQHGIALRLFHGRGGTVGRGGGPSYEAILAQPHGAVQGSVRVTEQG
EIISAKYGSAGAARRNLEALASATLEASLLKIDQVEEQYPEAYEIMGEISRLSQKKYSRL
AHEDPGFIEYFTSSTPLEEIGELNIGSRPSSRKQTKSIDDLRAIPWVLSWSQSRVMLPGW
YGVGSALHEWIEKGCAQTAELSPDERLVVLQELNSSWPFFSSVLSNMAQVMSKAEMQLAK
LYSGLVADQEAANRIFSDISAEFELTKKMFLKITGFSGLLDDNPMLARSVRSRYPYLLPL
NTLQLEMLRRYRKGDDDPKVVHGIRLAMNGLATALRNSG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaaaagctacgtctgcgggtccactatccgaacaacttgttgaggacatacgc
tttctcggtgctcttttaggggaggtgatcaaggaacaagaaggaatagcagcctttgac
cgggtggaggcagcaagacagctggcttttaagatttctcgtaaggaatcacaggttgaa
gacttagtggcattgctaaaggatatttcagcagcagatgcgataccaatcattagagca
tttagtcatttcgcgctactcgcaaacatggtggaggacttgcacgatgagttgggcaga
cttcagcgacaggaagccggtgaacaagatccagattcaactttaggcgccacatggaaa
aagctggcgaatgctggcataacaaatgaaaaagtttccagtttgctgagtaattttcaa
gtggctccagtgcttactgctcaccctacggaaacccgtagacgcacgatcttcgatgct
caagagcatatgactactctgcttaaaaagcgtcatgcgattcttagctctgagacaaat
gcgctgacaactgcacggcttgaagaaaatactcgtcatattcgtaggtggctgacctta
atatggcaaactgcgcttatccgtgtagcccgtcctcggattgaagatgaggtagaagtt
gggttgcgttattatgagctctctttactcactgcgatccctgagatcaataagcaagtg
gctgatcacatccagagagaatatggtgtgaactccgaagatgctttgcagtcactattg
attaagcccggaagctggatcggtggcgatcatgacggtaacccgtatgtcactgcagga
actctgcactacgcgacaacgcgagccgccgagactgttttaaagttttatgtacgtgaa
ctgcatcaacttgaacacgagttatcgttatcagacagactcaccgatgttagcccggat
ctgcgtaagcttgcagatctaggccataatgatgttccttcacgggtagacgaaccgtat
cgtcgtgccgtccatggtgtacgtggtcgagtacttgccacactagcttctcgaatcggc
ccagaaacagtagaaggctcatggtattcccgccatgctgcgtatactgcacctgagcaa
ctcgcagctgatttggacattatcgatgcttctttgcggagaactcacgatgagctcatc
gcagatgatcgtctgctgcgcatacggacagcagtatcgagctttggtttccatctttac
tcgatggatctgcgtcaaaactctgagagttacgaggacgtgcttactgagctctttgag
cgggcccaagtaactccgcactatcgaaaattagatgagagcgaaaaaattagcgttttg
atcgccgagctatcctcgccaaggcctctcattccgcgcgatggcttgccgtacagcgag
ttaacgcagcgggaactcgatattatttttgaggcaaagcaagccgtggatgcctttgga
acaatgatgattccacactctattatttcgatggcagaatctgcgagcgacattctcgag
ccaatggtcctactgaaagaatttggattaatcaagattcaagaaggccatctcacaggg
catattgacgttatacctctttttgaaacaatcgatgacctacaaaatggtgcaaagatt
ctccaagatttgtggcagataccgttgtatcgcagttatttagagcaacgaggcaatctc
caggaagtgatgctcggttattccgattccaataaagatggtggctaccttgccgcaaac
tgggctttatatgcggcagaaactgaccttgtaaacatatgtaagcaacatggtattgct
ctgaggcttttccacgggcgtggtggcaccgtagggcgtggtggcggtccctcttatgag
gcaattctcgctcagccacatggtgcggtgcaaggtagcgtacgcgtcacggagcaaggc
gagattatctcggcaaaatacggttctgcgggagctgctcgccgtaatctggaggctctg
gcctcagccacattggaagcttctttgctcaagatcgatcaagtagaagaacagtatcct
gaggcctatgaaattatgggcgaaatttcgcggttgagtcagaaaaagtattcgcggctt
gctcatgaagatcccggattcattgaatatttcacgtcatcgacgcctttggaagaaata
ggggagctcaacatcggctctcgtccttcctcgagaaaacagactaagagcatcgatgat
ttacgcgcgattccctgggtgcttagttggtcgcagtcacgtgtcatgcttcccggttgg
tatggagtaggcagtgctctacatgaatggatagagaaggggtgcgcgcagacagcggaa
ctatctccggatgaacgtctcgtggttctgcaagagcttaattcttcctggccattcttt
tcttcggtgttgtctaatatggcgcaggtgatgagtaaggctgagatgcagctcgccaag
ctctactcagggctagtagcagaccaagaagccgcaaacaggatattctccgatatctct
gctgaatttgagcttactaagaaaatgttccttaagattaccggtttttcggggcttctc
gacgacaaccctatgctcgcacgatcagttcggtcccgctatccatacttgctacctctt
aatacgctgcaacttgaaatgttacgtcggtatcgcaagggggatgatgaccctaaggta
gtgcatggtattcgtctggctatgaacggcttggccaccgcgctgcgaaattctggttag

DBGET integrated database retrieval system