KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_01892Help
Entry
cpfrc_01892       CDS       T01277                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
cpu00010  Glycolysis / Gluconeogenesis
cpu00071  Fatty acid degradation
cpu00350  Tyrosine metabolism
cpu00625  Chloroalkane and chloroalkene degradation
cpu00626  Naphthalene degradation
cpu01100  Metabolic pathways
cpu01110  Biosynthesis of secondary metabolites
cpu01120  Microbial metabolism in diverse environments
cpu01130  Biosynthesis of antibiotics
cpu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cpfrc_01892 (adhA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    cpfrc_01892 (adhA)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    cpfrc_01892 (adhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    cpfrc_01892 (adhA)
   00626 Naphthalene degradation
    cpfrc_01892 (adhA)
Enzymes [BR:cpu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     cpfrc_01892 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C adh_short TrkA_N Methyltransf_25 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: ADK29685
LinkDB All DBs
Position
complement(2073917..2075074)
Genome map
AA seq 385 aa AA seqDB search
MVVSPAGVMPVGVQSFRGLNEYRSQQGVGIDNAYEKGKIDVKTDFPEAFTAAVVDNFGPE
LNIHDVVLPEPGPNQALVKLVASGICHTDLHAAEGDWPVKPEPPFVPGHEGVGEVVKLGP
GHHRVQLGDMVGNVWLWSACGECEYCRTGRETLCNDAEYGGYTVDGSFGEYMLVDTRYCA
RIPEGSDPVEVAPILCAGVTVYKGLKETECKPGQYMVISGIGGLGHIAVQYAVAMGMRVI
AVDIADEKLELARKHGAEFAVNALKEDPVESINAFTSGGAHGVLVTAVHPQAFGQAIGMA
RKGGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQDLEEALDFYARGMIKPTVTEC
KLGDVNSVFADMHKGTVDGRMAIRY
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggttgtgtccccagccggcgtcatgccggttggggttcagtcgtttaggggacttaat
gaataccgttcccaacaaggtgtaggtattgacaatgcctacgagaaaggaaagatcgac
gtgaaaaccgatttccctgaggccttcaccgccgctgtagttgacaactttggccctgaa
ctcaatatccacgatgttgttttgcccgagccgggacctaatcaggcattggtaaagctg
gtggcctctggtatttgccatacagatcttcatgcggcggaaggggactggccggtaaaa
ccggaaccgccttttgtccccgggcatgaaggcgtgggggaagttgtgaaattgggaccc
ggccatcatcgcgtgcaacttggagacatggtgggcaacgtttggctttggtccgcctgt
ggggagtgcgagtactgccgcaccggacgtgaaaccctttgcaatgacgccgaatatggc
ggctatacggtcgacggctcttttggtgaatacatgctggtagatacccgctactgtgcg
cgtattccagaaggctccgatccagttgaagtggcccccatcttgtgtgccggcgtgacc
gtgtacaaaggcctcaaagaaaccgagtgtaagccgggccagtacatggtgatttccggc
atcggtggcctagggcatatcgctgtgcagtatgcggtggctatgggaatgcgagtgatc
gctgtggatattgcagatgagaagctcgagctggcgcgtaagcacggtgcagaatttgca
gtcaatgcgttgaaggaagacccggttgagtcgatcaacgcatttacctcaggtggtgcg
catggcgttttggtcactgccgtgcacccgcaggcgtttggacaagccatcgggatggcc
agaaaaggcggaaccatcgtatttaatgggcttcctccaggagagttcccggcaccgatt
tttgagattgtgttcaaggggttaactattcgcggttcattggtgggaacgcgccaggac
ctagaagaagccctggatttctatgcacgcggaatgatcaaaccgaccgttacggaatgc
aagcttggcgacgtcaacagtgtcttcgccgatatgcataaaggcacggttgatggtcgc
atggctattaggtattaa

DBGET integrated database retrieval system