KEGG   Coniophora puteana: CONPUDRAFT_120732Help
Entry
CONPUDRAFT_120732 CDS       T03134                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cput  Coniophora puteana
Pathway
cput00020  Citrate cycle (TCA cycle)
cput00310  Lysine degradation
cput00380  Tryptophan metabolism
cput01100  Metabolic pathways
cput01110  Biosynthesis of secondary metabolites
cput01130  Biosynthesis of antibiotics
cput01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CONPUDRAFT_120732
  09105 Amino acid metabolism
   00310 Lysine degradation
    CONPUDRAFT_120732
   00380 Tryptophan metabolism
    CONPUDRAFT_120732
Enzymes [BR:cput01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CONPUDRAFT_120732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 19199566
NCBI-ProteinID: XP_007766646
JGI: Conpu1_120732
LinkDB All DBs
Position
Unknown
AA seq 1005 aa AA seqDB search
MASRATLGRSLLLANASRVATRSSARLGCRTATTAGPPSPNDPFANGTNAYFAEEMYRQW
KEDPKSVHSSWSVYFAGLERGLPSAEAFQPPPNLITSSHGTSGPVQTQDSGNQLDEHLKV
QLLVRAYQVRGHHIAKLDPLGILDADLDGSRPPDLDLSRYGFTEKDMDKDIALGPGILPN
FATGDRKTMKLSEIIKLLERIYCGAVGFQYAHIPDSEQVEWIRDRVELPKPWNYTVEEKR
MILDRLVWSSSFEKFIASKFPNEKRFGLEGGESLIPGLKAMIDRSVDYGVKHVTIGMPHR
GRLNVLANVIRKPVEAILNEFSGSTDTVDGSPAGDVKYHLGANYVRPTPSGKKVSIALVA
NPSHLEAEDPVVLGKTHAIQHIEGDERTHNTAMAVLIHGDAAFAGQGVVYETMGFHNLPN
YGTGGTIHVIVNNQIGFTTDPRFARSTPYPSDIAKSIDAPIFHVNGDNVEAVNFVCQLAA
DYRAKFKRDVVIDIVCYRKHGHNETDQPSFTQPRMYEAIEKQPTTLEAYTQFLVGRGTFT
EKDIEEHRKWVWGMLDKAASEAKDYVPTSQEWLSASWPGFPSPKELKEMKLPTHATGVSE
DVLKRIGNAISTWPDKFAPHKNLARILMQRGKTVQEGKNIDWATAEALAFGSLALEKVHV
RLSGQDVERGTFSQRHAIVHDQNNEAQYVPLNELGSSQARFTVCNSSLSEFGALGFELGY
SLVSPNNLTIWEAQFGDFANNAQCIIDQFIAAGERKWLQRTGLVMSLPHGYDGQGPEHSS
GRIERFLQLCDDHPLVYPTVEKLERQHQDCNMQVVYPTTPANYFHVLRRQIHRDFRKPLI
LFFSKSLLRHPRARSDLAEMVGDIHFQHYIPEPHTSSLVAPEKVRRHILCSGQVYHTLLQ
AREERGIDDVAISRLEQISPFPYEQITPHLDKYPNADLLWCQEEPLNNGAWTYVGLRLQT
AASKTEHHKGKFPLYAGRDPTSSVATGSKTRHKKEIETFLNKAFA
NT seq 3018 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaagagcaaccctcggtcgctcgctactgctagcgaacgcgtcgcgcgtcgct
acacgctcttccgctcgcctcggatgcagaacagcgactacagctggccctccgtcgccc
aacgatcccttcgccaatggaacgaatgcctatttcgccgaggagatgtataggcagtgg
aaggaggacccgaagtcggtgcactcctcctggagcgtgtatttcgctggcctggagcgt
ggtctgcccagcgcagaagcgttccagcccccgccgaacctaatcacatcgtctcatgga
acatcgggtccagttcagacgcaagatagtgggaatcagctggatgagcacttgaaggtg
caacttctcgttcgcgcataccaagtccggggccaccacatcgctaagttggaccctctc
ggcatcttggacgctgatctagatggaagtcgtcccccggatctagacctcagtcggtat
ggtttcacggagaaagacatggacaaggacatcgctcttggccctggcatcctgcccaac
tttgctaccggcgaccgaaagaccatgaaactgagcgaaatcatcaagttacttgaacgt
atctactgcggagcggtcggcttccagtacgcgcacattccggatagtgagcaagtggaa
tggatcagggaccgcgtcgagcttcccaaaccgtggaactataccgtcgaggagaagcgg
atgattctagacaggctggtctggtcttcatcattcgagaagttcatcgccagcaagttc
cctaacgaaaaacgattcggtcttgaaggcggcgaatcccttatccccggtctgaaggca
atgattgataggtctgttgactatggcgtgaagcacgtcacgataggcatgccccaccgc
ggtcgcctgaacgttctggccaacgtcatccggaagcccgtcgaagccatcctcaacgag
ttctctggatccacagacaccgtggacggttcccccgccggtgatgtcaagtaccatctc
ggtgctaactatgtccgtcccacaccctcgggcaagaaagtgtcgatcgcgctcgttgcg
aacccctctcacctggaagccgaagatcccgtcgtgctcggaaagacccacgccatccaa
catatcgaaggcgacgagaggacacacaacacggcaatggcggttctcatccacggtgat
gcggcgtttgcgggacaaggtgtcgtgtacgaaacaatgggcttccacaaccttcccaac
tacggtaccggcggaaccatccacgtcattgtgaataaccagattgggttcaccacggac
cctcgttttgcgcggtccacaccatacccttccgatatcgccaagagcatcgatgctcct
attttccacgtcaacggtgataacgtcgaagctgtcaacttcgtctgccagctcgccgcg
gattaccgcgccaagttcaagcgtgatgtcgtaattgacatcgtgtgctaccgcaagcac
gggcacaacgagacggaccaaccgagcttcacgcagccgcgaatgtacgaggccatcgag
aaacagccgacaacgcttgaggcatacacccagttcctcgtcggccgcggcacgttcaca
gagaaggacatcgaagagcacaggaaatgggtctggggcatgctcgacaaggcggcgagc
gaggcgaaggactacgtgcccacgtcgcaggaatggctctccgcgtcgtggcccggcttc
ccatcgcccaaagagcttaaggagatgaagttgcccacacacgccaccggtgtatccgag
gacgtgctcaaacgcattggcaacgccatctcgacgtggcccgacaagtttgccccgcac
aagaaccttgcgcgtatcctcatgcagcgcggtaaaacggtccaggaggggaagaatatt
gactgggcgacggccgaggcgctcgcgttcggctccctcgcgctcgagaaggtgcacgtc
cgcctgtccgggcaggacgtcgaacgcggcacgttctcccagcgacacgccatcgtccat
gatcagaataatgaagcgcagtatgtcccgctgaacgaacttggctcatcccaggctcgc
ttcaccgtctgcaactcgtccctatctgagttcggcgccctcggttttgagctcgggtac
tcgctcgtctcaccaaataacctgaccatctgggaggcgcaatttggcgactttgctaat
aatgctcagtgtatcattgaccagttcatcgcggctggcgagcgcaagtggcttcagcgc
actgggcttgtcatgagcttgcctcatgggtacgatgggcagggcccggagcactcaagt
gggcggatagagcgtttcttacagctttgtgacgaccacccgctggtgtacccgacggtg
gagaagttggagagacagcaccaggactgtaacatgcaggtcgtttaccccacgacacca
gcgaactacttccatgtcctccgtcgccagatccatcgcgacttccgcaaacccctcatt
ctcttcttctctaagtcgctccttcgccacccccgcgcccgctccgacctcgccgaaatg
gtcggcgacatacacttccagcactacattcctgaaccgcacacatcttcgcttgtcgcg
cccgagaaggtccgacgacacatcctctgcagcgggcaggtgtaccacacgctcttgcaa
gcacgtgaagagcgtggaatcgacgacgtcgcgatcagccgactcgagcagatctcgccg
ttcccgtacgagcagatcaccccccatcttgacaagtaccccaacgcagatctgctgtgg
tgccaggaggagccgctgaataacggcgcgtggacatatgtcgggctccgcctccagact
gcggccagcaagacagaacaccacaagggcaagtttccgttgtacgccgggcgcgacccg
acgagctcggttgctaccggtagcaagacgcgacacaagaaggagatcgagacgttcttg
aacaaggcgtttgcttga

DBGET integrated database retrieval system