KEGG   Coniophora puteana: CONPUDRAFT_125886Help
Entry
CONPUDRAFT_125886 CDS       T03134                                 

Definition
(RefSeq) SET domain-containing protein
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
cput  Coniophora puteana
Pathway
cput00310  Lysine degradation
cput01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    CONPUDRAFT_125886
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cput03036]
    CONPUDRAFT_125886
Enzymes [BR:cput01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     CONPUDRAFT_125886
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     CONPUDRAFT_125886
Chromosome and associated proteins [BR:cput03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     CONPUDRAFT_125886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 19199936
NCBI-ProteinID: XP_007769944
JGI: Conpu1_125886
LinkDB All DBs
Position
Unknown
AA seq 410 aa AA seqDB search
MDGSKPTVATVSGPTSFCRAAAETVLGDPSSIKLRLKVSIGPVPDASSLAFTLGLGLDFA
FSPLLKLQRTPYGGRSLFAAQAIPAGTLLHVCAAPHAHVVYRAFRKEVCARCFAYATQAQ
KRVQAGFGAGAPYFCGEACRDAWIVVAQIEQILADEAPEEHEEQLGITKNGTRPEMAKEQ
LDRAWGRVEAWTKAKYGRSGPPLPFALDEGELDIARFAVSAIVRRHQEADPPFAEPELAI
SRLLSLQDSELANVRMRPYLLRAHLRVCAFLGAALPPPLRAHVGVVRQLLARETGNAFGI
WEGDQLPEGRISIGDSEKEAEDTRDMREREMFGWGVWVSASLFNHSCAPNVRKKRSGRSL
EFFTLRDVKEGEELRISYASTDKPVGERREALRTSWFFDCMCSRCVRESS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggacggatccaagccaacagttgccacagtctccggccccacctccttctgccgagca
gcggcagaaaccgttttaggtgatccgtcttcaatcaaacttagactcaaagttagcatt
gggcccgttccggatgcgagctccctagcctttaccttgggattgggcttggacttcgcc
ttctccccactcctgaagctacagcgcacgccctacggcggacgctcgctcttcgccgcg
caggcgatcccggcgggtacactgttgcacgtctgtgcggcgccgcatgcgcatgtggtc
tatcgtgcgttccgcaaggaggtgtgtgcgcggtgttttgcgtatgctacgcaggcgcag
aagcgagttcaagctggattcggggctggagcaccgtatttctgcggtgaggcttgtcgg
gacgcgtggattgtggtcgcacaaatagagcagatcctcgcagacgaggcaccagaggaa
catgaagaacagctgggaatcaccaagaacgggacgcgaccggagatggcgaaggagcag
ctagatagagcttggggacgcgtcgaagcatggacaaaggcaaaatacggtcgaagcggt
ccacctctcccgtttgcattggacgaaggagagctcgacattgctcggttcgccgtcagc
gccattgtccgcagacatcaagaagccgatcctccattcgccgagccggagctcgcaatt
tcgaggcttctgagcctgcaggacagcgagcttgcgaacgtccggatgcgcccgtatctc
ctgcgcgcgcacctgcgtgtgtgcgcgtttctgggtgctgctttgccgccgccgctgcgt
gcacacgtgggcgtcgtgaggcagctccttgcgcgcgagacaggaaacgcgttcgggatc
tgggaaggcgaccagctacctgaagggaggattagtataggtgactcggagaaggaggca
gaggacacgagagacatgcgggaacgcgagatgtttgggtggggggtgtgggtgagcgca
agcctgttcaatcactcgtgcgcgcccaacgtgcgcaagaagcggtctgggcgttcgttg
gagttcttcacgttgcgagatgtgaaggagggcgaggagctgcgtatttcgtacgccagt
acggataagcccgttggagaaagacgggaggcgctacggacgagctggttcttcgactgc
atgtgctcgcgatgtgtgcgagagagtagctga

DBGET integrated database retrieval system