KEGG   Coniophora puteana: CONPUDRAFT_135071Help
Entry
CONPUDRAFT_135071 CDS       T03134                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cput  Coniophora puteana
Pathway
cput00250  Alanine, aspartate and glutamate metabolism
cput00410  beta-Alanine metabolism
cput00430  Taurine and hypotaurine metabolism
cput00650  Butanoate metabolism
cput01100  Metabolic pathways
cput01110  Biosynthesis of secondary metabolites
Module
cput_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CONPUDRAFT_135071
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CONPUDRAFT_135071
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CONPUDRAFT_135071
   00430 Taurine and hypotaurine metabolism
    CONPUDRAFT_135071
Enzymes [BR:cput01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CONPUDRAFT_135071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 19200702
NCBI-ProteinID: XP_007764805
JGI: Conpu1_135071
LinkDB All DBs
Position
Unknown
AA seq 542 aa AA seqDB search
MALSKHINPDTLIKESKDKKNHHHQLTKSDPNKIHHPYGARYGTASIPKYHLPSTGTDAE
DAYQLIHDELSLDGNPSLNLASFVHTWMPEPGTKLMVENMSKNLIDQDEYPMTQMIHTRC
VSILADLWHAPSTQQAIGSATTGSSEAIQLGGLAMKRRWQERRKAEGKSIHEPGPNIIMG
ANAQVALEKFARYFEVECRLVPVSEESKYRLDTKKAMEVVDENTIGVFVILGSTYTGHYE
PVKEMSDLLDEYEAKTGLNIPIHVDGASGAFIAPFAHPKLLWDFKLPRVVSINASGHKFG
LSYVGVGWVVWRSKDHLPKDLIFELHYLGSVEYSFSLNFSRPAAPIIAQYFNFLHLGFEG
YRAVALDDLRNARVLSRALERTGWYQVLSDIHRLKSTALVQGTQVTLGLDEENVENYTEG
LPVVSFRFKDDFKQQYPEVQQKWVQTLLRVKGWIVPNYELAPDLEHVEILRVVVRENMTE
ALIDQLVSDIVQITQDLVDKSSSTHALDMLGAQNHHRSSHHTSGKLDEGSGSKSSGTYAK
QC
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggctttgtcaaagcatatcaaccccgacacactcatcaaagagtctaaggacaagaag
aatcatcaccaccaacttaccaagtctgatcctaacaaaatccaccatccttacggtgct
cgctatggcacagcctctattcccaaataccacctcccttccacgggcaccgacgctgag
gacgcttatcagctcatccatgatgagctttccctcgatggtaaccccagcttaaaccta
gcttcttttgttcatacttggatgcccgagcctggtacaaagctcatggtggagaacatg
tccaagaacttgatcgatcaggatgagtatccaatgacccaaatgattcacactcgctgc
gtctccattctggccgatctttggcacgccccatctactcagcaggctattgggtccgcc
acgactggttcctccgaagctatccagctcggtggtcttgcgatgaaacgtcgctggcaa
gaacgtcgcaaggccgagggaaaatctatccacgaaccgggccccaacatcatcatgggt
gccaatgctcaagttgctctcgagaagtttgcccgctactttgaggttgagtgtcgtttg
gtgcccgtgagcgaggaaagtaaataccgtctggataccaaaaaagctatggaggtggtt
gacgaaaacacgatcggtgtcttcgttatcctcggcagtacttacaccggccactatgaa
ccggtcaaggaaatgtccgacctcctcgacgagtatgaagccaagacagggctcaatatt
cccattcacgtggatggtgcctcgggtgctttcattgcgccgttcgcgcatcccaagtta
ttatgggacttcaagctcccgcgtgttgtatctatcaacgcttctggccacaagtttggc
ctttcgtatgttggcgttggctgggtcgtctggcgctctaaagatcacctcccgaaagac
ctcatctttgaattgcactaccttggctcagtcgagtactcgttctcactcaacttctcc
cgtccggctgcacctattatcgcccagtatttcaatttcctccacctcggctttgagggt
taccgtgctgttgccctcgatgatctgagaaatgcgcgagtgctctcgcgcgctttggag
cggacggggtggtatcaagtcctaagtgacattcacaggctcaagagtacggcgcttgtc
caaggaactcaagtgactttgggacttgacgaggaaaatgttgagaattacacagagggg
ttgccagttgtttccttccgcttcaaagacgatttcaaacagcaataccctgaggtccag
cagaaatgggtccagactttgcttcgcgtgaagggctggattgtgcctaattacgaactc
gcccctgatctggaacatgtcgagattttgcgggtggtggttcgcgagaatatgaccgaa
gctctcattgaccagcttgtatccgacattgtgcaaatcactcaagatttggtggacaaa
tcttcgtcgactcatgcactcgatatgcttggggcgcagaatcatcatcgctcatcccat
cacacctctggcaagctggacgaaggctctggatccaagtcgtctggcacatacgcgaag
cagtgctaa

DBGET integrated database retrieval system