KEGG   Coniophora puteana: CONPUDRAFT_139208Help
Entry
CONPUDRAFT_139208 CDS       T03134                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
cput  Coniophora puteana
Pathway
cput00562  Inositol phosphate metabolism
cput01100  Metabolic pathways
cput04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CONPUDRAFT_139208
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    CONPUDRAFT_139208
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cput01009]
    CONPUDRAFT_139208
Enzymes [BR:cput01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CONPUDRAFT_139208
    3.1.3.48  protein-tyrosine-phosphatase
     CONPUDRAFT_139208
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     CONPUDRAFT_139208
Protein phosphatases and associated proteins [BR:cput01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    CONPUDRAFT_139208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase3 PTPlike_phytase Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 19201311
NCBI-ProteinID: XP_007772623
JGI: Conpu1_139208
LinkDB All DBs
Position
Unknown
AA seq 608 aa AA seqDB search
MTDVIRRFVSGNKARFKDKHLHLELDLVYVTDQVIVMGYPAIGLEGLYRNRRDDAKKFLE
HRHGKNYWVFNFCPVRENSYAPTVFDGRVSRYPFPDHHAPPLAVLPLVAREMRAWLDGSP
DRVAVLHCKAGKGRSGTLACSYLLSMDITPHPPRLERSNTTKQWAQVKVEKLMQVMPTDD
PSGSQPASPRVSVETLSSAEDLTSPAETVPSTSTVTIHGEEHPNGTIDVAPVSLKHVLDL
HTSRRMKSPSSPTKKVKQGVSIPSQRRWLGYWSQLLANQGPHGFWEVDTIKPKPKVRLTE
IKVRMKDLGGVRVSLVRAANMVIDRTKYGRSGGSKGNEQGHVWVSLARYDDVLAEELEAC
ERATRHESGNMGKVRTALNEDGERETSRHFFTDSQWDSTKMVRSFARMGVIGNNAVQTEK
AGDEFLTKYVLRPLSDERWVTIKEDIPHATNGDSGVVNDAVPSETNSIADVTHPSHERGI
VVDAHREIRVKFYMGQVFIAWLWLIPAFHVDLPAMTPGTASTILLTRKDTDFPVGIGSAL
LDVEISFERCAEEEPEQPPGFSHPHSVTTPAGEAEGYADEPTGIAANVDSIATDVVGGFV
ETTQATAN
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtcatccgccgtttcgtgtctggcaacaaagcgagatttaaagacaagcac
cttcaccttgagctagatctagtatatgtgaccgaccaggtcatcgttatgggctacccc
gccatcgggctggagggactctatcgcaatcgccgtgatgatgcgaagaagttcctcgag
catcgtcatggcaagaactactgggtgttcaatttctgccccgtccgcgagaattcgtat
gcgccgactgtatttgatggaagagttagtcggtatccattccctgatcaccacgcacct
ccgcttgctgttctccctctcgttgctcgagagatgcgtgcgtggttggatggatctcct
gacagagttgctgtgcttcactgcaaagctggcaagggcagatctggcacccttgcttgc
tcatacctgctctccatggacatcacgcctcacccgcctcgcctcgagcgcagcaacacc
accaagcaatgggcgcaggtcaaagtggaaaagcttatgcaggtcatgccaaccgacgac
ccctctggtagtcagcccgcctctccacgcgtgtccgtcgagacgctctcaagcgcagag
gatctcacgtcccccgctgaaaccgtcccttccacaagcactgtcacgattcacggcgaa
gagcaccccaatgggacgatagatgtcgcgcccgtctccctgaagcatgtgctcgacctg
catacgtcccggcggatgaagtcgccttcgtcgccaacgaagaaggtcaaacaaggtgtg
agcatccccagccaacggcgctggctcggttactggtcgcagctgctcgcgaaccagggc
ccacatggcttctgggaagtcgacactattaagcccaagccaaaagtgcgcctgacagag
atcaaggttcggatgaaggacctcggcggggttagggtctcactcgtgcgcgccgcgaac
atggtcatcgaccggaccaagtacgggcggagcggtggaagcaaggggaacgagcaggga
cacgtgtgggtgtcgctcgcgcggtacgacgacgtgctcgcggaggagctcgaggcttgc
gagcgtgcgacacggcatgaaagcggtaacatgggcaaagtgaggacggcgctgaacgaa
gacggcgaacgcgagacatcgagacatttcttcacggattcgcagtgggattcgaccaag
atggtgcggagttttgcgcgtatgggtgtgattgggaacaacgcggtgcagaccgagaaa
gccggagatgagtttctgacaaaatacgttctacggcctctttcggacgagcggtgggtc
accatcaaggaggacatccctcacgcgaccaacggagacagcggtgtcgttaatgacgca
gtgccctctgagaccaactccatcgccgacgtgactcacccgagccatgaacgcggcatc
gtggtggatgcacaccgcgaaatacgcgtcaaattctacatgggccaggtgttcattgcg
tggctttggttgatccctgctttccacgttgatcttcccgccatgacgcccggaacggcg
agcacgattctcctcacccgcaaagatacggattttccggttggaattggttccgcgctg
ttggacgtggaaatatcgttcgagcgctgcgcagaagaggagcccgagcaacctccgggc
ttctcacacccgcacagcgtcacgactcctgcaggagaagcggaaggttacgcggacgag
ccaacgggtattgctgcaaacgtagactccatcgcaacggacgtggtcggagggtttgtc
gaaacgacgcaggccaccgcaaattga

DBGET integrated database retrieval system