KEGG   Coniophora puteana: CONPUDRAFT_153600Help
Entry
CONPUDRAFT_153600 CDS       T03134                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cput  Coniophora puteana
Pathway
cput04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cput00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CONPUDRAFT_153600
Enzymes [BR:cput01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CONPUDRAFT_153600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 19203151
NCBI-ProteinID: XP_007768485
JGI: Conpu1_153600
LinkDB All DBs
Position
Unknown
AA seq 198 aa AA seqDB search
MDINYGTPKSSRKPVFITAAVTAVVMFLLFSAVYNPKAEPEQILVKKAVVVLKGDSAVSG
TVTFEQSSVTGAVSVSGKIEGLDPSTQRGFHIHQLGDLSDGCTSTGSHFNPYGNTHGAPA
DEVRHVGDLGNIESDENGVADFSLRDSVISLNGERSIVGRAVVVHTGTDDLGRGGNEDSL
KTGNAGGRAACGVIGLVE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggacattaactacggaacaccaaagagctcgaggaagcccgtcttcatcacggccgcg
gtgacggctgtggtcatgttccttcttttctctgccgtgtataaccccaaagcagagcct
gaacagattctggtcaagaaggctgtggttgtgctcaaaggagactcggccgtctctggt
actgtgacgttcgaacagtcgtccgtgactggtgctgtcagcgtctccggcaagattgaa
ggcctcgacccttctactcagcgcggcttccacatccaccagctgggtgacttgagcgat
ggatgcacatccactgggtcgcactttaatccttatggcaacacgcacggagcccccgct
gatgaagtgaggcacgttggggatttgggaaacattgaaagtgacgagaacggggttgcc
gatttctcgttgcgtgactcggtgatatcgctgaatggagagcggagtattgttggtcga
gctgttgtggtgcacacgggtaccgacgatctcggccgtggtggcaacgaggactccctg
aagactggcaatgcaggcggccgcgctgcttgtggcgtaatcggcctcgtcgagtaa

DBGET integrated database retrieval system