KEGG   Coniophora puteana: CONPUDRAFT_169078Help
Entry
CONPUDRAFT_169078 CDS       T03134                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cput  Coniophora puteana
Pathway
cput00052  Galactose metabolism
cput00500  Starch and sucrose metabolism
cput01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CONPUDRAFT_169078
   00500 Starch and sucrose metabolism
    CONPUDRAFT_169078
Enzymes [BR:cput01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CONPUDRAFT_169078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 19206141
NCBI-ProteinID: XP_007773826
JGI: Conpu1_169078
LinkDB All DBs
Position
Unknown
AA seq 786 aa AA seqDB search
MKSLALCLVALASASKALGSNSTYSYNVTSCPGYTLQDLKQSDTGLTAHLNLAGEACNAF
GNDIQNLTVEVTYETQQRLHVNIFDNAQQQYTIPSSVVPVPEPPTTSYANSSDLVFNYDA
SSFAFWITRRSDPAGSMPLFDTRTASLPKTPIAPVNATDNSTALDSFELIFEDQYLQLAS
ALPQNTNIYGLGEVVASSGFRRDVGGNGGPGSIQTLWTRDSPTPEDQNIYGSHPIYMEHR
SNGADILLTTPPESNVSLIEYRLLGGTLDSYFFSGPSPVSVIEQYGEMIGYPAWVPAWGF
GYHRHHANGQHYIPIVDVAIATPQNSTDLYAPFVDGFEKDVWIKNPNGTVFVGSLWPGFV
AWQDWFAPNTQDWWTQALKNWSESGIEFDGIWLDMNEPSSLCAGSCGSANFSQSGFPGAK
RAVGNETGLDVMSPPYAIHNGHGPSDNRTVSPDAVHAGGYSHYDTHNMYGLMEEIATHGA
LQTLRAGKRAFIIARSTFLSAGKWAGHWLGDNYSTFQSMSLSIQGILQFQLYQIPMVGSD
TCGFIGNTTEELCNRWHMLSAFAPFYRNHNGGSNPQEPYRWPSVANATRIAIAARYALLP
YWVPNPLRECIDSRLSHRALWYEFPNEPELFGVDGQYLIGSDILVTPVLEENATTVDGIF
PGRGSVTWRDWWTHATVNASTSGGNTTLQAPPSTINVHIRDGSALLLHAKPGYTINETRS
GPYELLVSLDKGGNAFGTAYVDDGESSPPGDSRTLSFVAQGGALTISSQGGYDIQQKLES
VTVLVV
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgctagcgctttgcttggtggcgctcgcgtctgccagtaaggcactcggttcc
aactctacgtactcatataatgtaacgagctgccctggatacactctgcaggatctcaag
caatccgacactggactcaccgcgcacctcaaccttgccggagaagcatgcaatgccttt
gggaatgacattcaaaacctgaccgttgaggtcacgtacgagacccagcagaggttgcat
gtcaatatcttcgacaacgcacagcaacagtacactatcccctcttcggttgtccccgtc
cctgaaccgcccacgacgtcgtacgcaaacagttctgacctcgtgttcaactacgacgcg
tcgtcattcgcgttttggatcacacgccgctctgacccagcaggctcgatgccccttttc
gatacacgcacagcgtcgctacccaagacgccgattgctcctgtgaatgcgacggacaac
tcgactgcgctggacagctttgagcttatttttgaggatcagtatctccagttggcatca
gctttgcctcaaaacacgaatatctatggactcggcgaggttgtcgcgagcagcggtttc
cgacgcgacgtcggcggaaatggtggacctggctccatccagacgctgtggacacgcgac
tccccaactccagaggaccagaacatatacggttcgcatccgatctacatggagcaccgc
tcgaacggagccgatattctgctgaccactcctcccgagtctaatgtttcgctgatcgag
taccgcctcctcggcggcacgctcgactcctacttcttctccggcccatcgcccgtgtcg
gtgattgagcagtatggcgagatgattgggtacccggcgtgggtgcccgcatggggcttt
gggtaccatcgacatcacgccaatggacagcactatatcccaattgtggacgtcgcgatt
gcgacaccacagaactctaccgacctctacgcacctttcgtcgatggattcgagaaggac
gtctggatcaagaacccgaacggcactgtcttcgtcggctctttgtggcccggattcgtc
gcttggcaggattggttcgcgcccaacacccaagattggtggacgcaggcactcaagaac
tggagcgagtcgggcatcgagttcgacgggatctggctggacatgaacgagccgagctcg
ctgtgcgccggttcgtgcggctcggctaacttctcccagtctggtttcccgggtgcgaag
cgcgcggtggggaatgagacgggcttggatgtgatgagtccgccgtatgcgatacataat
ggccatggcccgtcggacaaccgcacggtctcgcccgacgcggtgcatgcgggcgggtac
agccattatgacacccacaacatgtatgggctgatggaggaaatcgcgacccatggcgcg
cttcagacgctccgagcgggaaagcgcgcattcattatcgcgcggtcgacattcctttcg
gctggaaagtgggctggccactggcttggagacaactacagcacgttccagtcgatgtcc
ctcagcatccaaggcattttacagttccagctgtatcagattcccatggttggctcggat
acatgcggtttcatcgggaacacgactgaagaactgtgcaaccgatggcacatgctttct
gcgttcgcgcccttctacaggaaccacaacggcggatctaacccccaggaaccataccgc
tggcctagcgttgcgaacgcaactcgcattgcgattgctgcgcgatatgcgctgctgccg
tactgggttccaaaccctcttcgcgaatgcatcgactcaaggctctcccatcgcgcgctg
tggtacgaatttccgaacgagccagagctcttcggcgtcgatggtcagtacctcattgga
agcgacattctggtcacgcccgtgttggaagagaacgccacgacagtcgatggcatcttc
cccggtcgcggcagcgtcacttggcgggactggtggacgcacgccaccgtgaacgcgagc
acctcgggcgggaacacgacgctgcaggcaccaccgagcaccatcaacgtgcatatccgg
gacggctctgcgctcctcctgcatgctaagccagggtacacgatcaatgagacgcgtagt
ggaccatacgagctgcttgtctctctcgataagggtgggaacgcgttcgggacggcgtat
gtcgacgacggggagagttctccgccaggcgacagtcgtaccttgagcttcgtcgctcaa
ggtggggcgttgactatctcgagccagggaggctacgacatccagcaaaaactcgagagc
gtgacggttttagtagtgtga

DBGET integrated database retrieval system