KEGG   Coniophora puteana: CONPUDRAFT_57020Help
Entry
CONPUDRAFT_57020  CDS       T03134                                 

Definition
(RefSeq) glutathione-S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cput  Coniophora puteana
Pathway
cput00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CONPUDRAFT_57020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cput02000]
    CONPUDRAFT_57020
Enzymes [BR:cput01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CONPUDRAFT_57020
Transporters [BR:cput02000]
 Other Transporters
  Pores ion channels [TC:1]
   CONPUDRAFT_57020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_N_4 GST_C_5 Glutaredoxin DUF2379
Motif
Other DBs
NCBI-GeneID: 19207844
NCBI-ProteinID: XP_007769012
JGI: Conpu1_57020
LinkDB All DBs
Position
Unknown
AA seq 258 aa AA seqDB search
MPSTFPDHNIHPEATGIAKKTVDAHQKPEELVFWSGWFCPFNQRVWIILEEKGIPYQYKE
VNPYAKEESFLKLNPRGLVPTIEYQGKPLYESTVLCEFLEDVYLDRPPHVLPKDPYEKAR
VRIWADHTSKHIIPAWHRLLQLQTKEDQDKARQDLYEAQRKLAEEIKGPYFAGEEFGLVD
VLNVPWVSRDHVLREYREYKREGAGENYARWADLLEKRDSVVKTTSDKDKLMVIYDRYLA
GTANSEVAKAIREGKPLP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcaccttccctgatcacaacattcatcccgaagccaccggtattgcgaagaag
accgtcgacgcgcatcaaaagcccgaagagctggtcttctggtcaggatggttctgtccc
ttcaatcaacgcgtctggattatcctcgaagagaagggcattccctaccagtacaaggag
gtgaacccgtacgctaaggaggagtctttcctcaaactcaaccctcgcggactcgttccc
accatcgagtaccagggcaaacctctgtacgagtccacagttctctgcgaattcctcgag
gacgtatatctggaccggccgccgcacgtccttcccaaggacccgtacgaaaaggcccgc
gtgcgcatttgggcagatcacacgtcaaagcacatcatcccggcgtggcatcggcttctc
cagcttcagaccaaggaagaccaagacaaggcccggcaggatctgtacgaggcacagcgc
aagctcgcggaggagattaagggtccatactttgctggtgaggaattcgggttggtcgac
gtgctaaacgtgccttgggtctcgcgcgaccatgtcctccgcgagtatcgcgagtacaag
cgtgaaggggcaggcgaaaattacgcgcgatgggctgacctactggaaaagagggacagt
gtcgtgaagacgacaagcgacaaagacaagctcatggtcatctatgatcgctatttggcg
ggcacagcgaacagtgaagtagcgaaggctatcagagagggtaaacctcttccatga

DBGET integrated database retrieval system