KEGG   Coniophora puteana: CONPUDRAFT_67119Help
Entry
CONPUDRAFT_67119  CDS       T03134                                 

Definition
(RefSeq) glycoside hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
cput  Coniophora puteana
Pathway
cput00500  Starch and sucrose metabolism
cput01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CONPUDRAFT_67119
Enzymes [BR:cput01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CONPUDRAFT_67119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 19208549
NCBI-ProteinID: XP_007775116
JGI: Conpu1_67119
UniProt: R7SFT1
LinkDB All DBs
Position
Unknown
AA seq 570 aa AA seqDB search
MLLQGALATLGLCTSVFAQDVSSYISSEGPIALTGVLNNIGPNGSKAPGADAGVVVASPS
TSNPNYFYTWIRDSSLTFQVLIDRLVSGQDTSNQGLIDDFTVAYANIQQVTNPSGSVSSG
GLGEPKFYVNETAFDGSWGRPQRDGPALRSTAFITYANYLISKNNQTYVQNTLWPAIKLD
LDYVAANWNQTTFDLWEEIQSSSFFTTAVQHKALRLGSALASTLGEDHSTYDTQAGDVLC
FLQSYWNPSPGYMTANTGGGRSGKDANTVLASIHTFDPAAACDSVTFQPCSDLALSNLKT
YVDSFREIYTVNSGISASAAAAVGRYPEDVYQGGNPWYLALFAVAEQLYDALYVWDQQGS
LSISDISLGFFKQFDSGAASGSYASSSAEYTNLTGAIKSFADGFIALNAKYTPSGGGLAE
QFSRDDGTPTSAVDLTWSYASALTAFDRRAGSVPGSWGAKGLTTSCGQSKIGESTTTSVT
FSVNKTTSLGQAIYLTGSVAALSSWSTSNAVLLSTLDYPVWSTTLNLPSSTAITYKYFVL
ENGQVTWESDPNNSITTAASGSQTLNDTWH
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgctcctccaaggtgcgcttgccacgctcggcctctgcacgtctgtcttcgcgcaggac
gtgtcctcctacatctcctccgagggacccatcgccttgaccggcgttctcaacaacatc
ggtcctaatggctcgaaggcgcctggtgctgatgccggtgtcgtcgttgccagtcctagc
acctcaaacccgaattacttctacacttggatccgtgactcgtccctcacgttccaggtc
ctgatcgaccgcctcgtgagcgggcaggacacctcgaaccagggtctcatcgacgacttt
accgttgcatacgccaacattcagcaggtcaccaacccgagcgggagcgtcagctccggt
ggtcttggcgagccaaagttctacgtcaacgagacagcttttgatggaagctggggtcgc
ccgcagcgcgacggcccggcgctgcgctcgaccgcgttcattacctatgccaactacctc
atctcgaagaacaaccagacgtatgtccagaacacgctctggcccgcgatcaagctcgac
ctcgattacgtcgccgcgaactggaaccaaaccacgttcgacctttgggaagagattcaa
tcatcctcgttcttcaccaccgctgtgcagcacaaggcgctccgcctcggctccgcactc
gcgagcacgctcggggaggaccacagcacctacgacacgcaggctggcgacgtcctgtgc
ttcctgcagtcctactggaacccctcgcccgggtacatgaccgcaaacacgggcggcggg
cgctcgggcaaggacgcgaacaccgtcctcgcgtcgatccacacgttcgaccccgccgcg
gcctgcgactccgtgacgttccagccgtgctcggacctggcgctgagcaacctcaagacg
tacgtcgactccttccgcgagatctacaccgtcaacagcggcatctccgcgagcgccgcg
gccgccgtcggccggtacccggaggacgtgtaccagggcggaaacccgtggtacctcgcg
ctgttcgccgtcgcggaacagctgtacgacgcgctgtacgtgtgggaccagcagggctcg
ctgagcatctccgacatctcgctcggcttcttcaagcagttcgacagcggcgcggcgtcg
gggagctacgcgagctcgagcgcggagtacacgaacctcacgggcgcgatcaagagcttc
gcggacgggttcatcgcgctcaacgcgaagtacacgcccagcggcggcgggctcgcggag
cagttcagcagggacgacggcacgccgacgagcgcggtcgatctgacgtggagctatgcg
tctgcgctcacggcgttcgataggcgcgcgggcagcgtgccgggttcgtggggcgccaag
gggctcacgacgagctgcggccagagcaaaatcggagaaagcacgacgacgtcggtcacg
tttagcgtcaacaagacgacctcgctcggacaggccatctacctgaccggcagcgtcgcc
gcgctgagctcgtggtcgacctcgaacgccgtcctcctctcgacgctcgactaccccgtc
tggagcacgacgctcaacctaccctcgagcactgcaatcacctacaagtacttcgtcctc
gagaacggccaggtcacctgggagtccgacccgaacaacagcatcacgactgccgcgagc
ggctcgcagacgctcaatgatacatggcattga

DBGET integrated database retrieval system