KEGG   Coniophora puteana: CONPUDRAFT_78931Help
Entry
CONPUDRAFT_78931  CDS       T03134                                 

Definition
(RefSeq) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cput  Coniophora puteana
Brite
KEGG Orthology (KO) [BR:cput00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cput03012]
    CONPUDRAFT_78931
   03029 Mitochondrial biogenesis [BR:cput03029]
    CONPUDRAFT_78931
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cput04147]
    CONPUDRAFT_78931
Translation factors [BR:cput03012]
 Eukaryotic Type
  Elongation factors
   CONPUDRAFT_78931
 Prokaryotic Type
   CONPUDRAFT_78931
Mitochondrial biogenesis [BR:cput03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CONPUDRAFT_78931
Exosome [BR:cput04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CONPUDRAFT_78931
  Exosomal proteins of breast cancer cells
   CONPUDRAFT_78931
  Exosomal proteins of colorectal cancer cells
   CONPUDRAFT_78931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 19209836
NCBI-ProteinID: XP_007762780
JGI: Conpu1_78931
LinkDB All DBs
Position
Unknown
AA seq 461 aa AA seqDB search
MSMLRLAAQRTVASRAICSSTRAVRPLSLLARGRSTAWNASTRTFAPVPLNATFRRGYAD
ASKFSRAKPHMNIGTIGHVDHGKTTLTAAITKVLSDSGDAQFTDYSQIDKAPEEKARGIT
INSAHVEYESGSRHYGHIDCPGHADYIKNMITGAAQMDGAIIVVSATDGQMPQTREHLLL
ARQVGIKKLVVFINKVDMVQDPEVLELVDMEMRDLLSTYNFDGENTPIIMGSALAALEGR
DDEVGATKIRELVQACDEWLDVPARDLDKPFLMPVEDVFSISGRGTVSTGRVERGIANKG
DEVEIVGLGASFKTTLTGIEMFHKELDRGEAGDNMGCLLRGVKREQIKRGQVLIAPGSMK
AVKKFQAQIYVLTKDEGGRYTPFMSNYRPQLFLRTADITTSLSFPEGTPDAEERMVMPGD
NVEMVCDLVHDVAAEEGSRFTLREGGKTIGTGIVTKVLEHA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgttgcgtctcgctgcccagagaaccgttgcaagcagggcaatctgctcctcc
accagagctgttcgcccgctctccctccttgcacgcggccgttccaccgcctggaatgcc
tctacccgcacttttgctccagtgcctctcaacgccactttccgtcgcggctatgctgac
gcctccaagttctcccgtgccaagccgcacatgaacattggtaccattggtcacgtcgac
cacggcaaaaccactctcactgctgccatcacaaaggttctctccgactctggcgatgct
cagttcaccgattactctcaaatcgacaaggcgccagaggagaaagcccgtggcatcact
atcaattccgcccacgtcgaatacgagagtggttcccgccactatggtcacattgactgc
ccaggacatgctgattatatcaagaacatgattactggtgctgctcagatggatggcgca
atcattgttgtctccgctaccgatggccaaatgcctcagactcgcgaacatctccttctc
gcccgtcaagtcggtatcaagaagctggtcgtcttcatcaacaaggtcgacatggttcag
gaccctgaagttctcgagctcgtcgacatggaaatgcgcgaccttctctcgacctacaac
tttgatggtgaaaatacacccattatcatgggctcggctttggccgctctggagggtcgc
gacgacgaagttggtgcgacgaaaatcagggagctggtccaagcttgcgatgaatggctt
gatgttcctgcccgcgacctcgataagccattcctcatgcctgttgaggacgttttctcc
atctcgggtcgtggtaccgtttcgaccggtcgtgtcgagcgcggtatcgccaacaagggc
gatgaagtcgagatcgttggtcttggcgcgtcgttcaagaccactttgaccggaattgag
atgttccacaaagaactcgacagaggtgaagccggtgacaacatggggtgtttgctccgt
ggtgtcaagcgggagcaaatcaagcgtggtcaggtgttgattgcccccggctcgatgaag
gctgtcaagaagttccaggcccagatttacgtcttgaccaaggatgagggtggtcgttac
actcccttcatgtccaactatcgccctcagctcttcctgcggactgcggatattaccaca
tcgttgagcttccctgagggcacgcctgatgctgaagagcggatggtgatgcctggagac
aacgtggagatggtttgcgacctcgttcacgatgttgcagctgaggagggttctcgcttt
acccttcgcgagggtggcaaaaccattggtaccggcattgtgacgaaggttctcgagcac
gcataa

DBGET integrated database retrieval system