KEGG   Coniophora puteana: CONPUDRAFT_79706Help
Entry
CONPUDRAFT_79706  CDS       T03134                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cput  Coniophora puteana
Pathway
cput00020  Citrate cycle (TCA cycle)
cput00190  Oxidative phosphorylation
cput01100  Metabolic pathways
cput01110  Biosynthesis of secondary metabolites
cput01130  Biosynthesis of antibiotics
cput01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CONPUDRAFT_79706
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CONPUDRAFT_79706
Enzymes [BR:cput01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CONPUDRAFT_79706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 Lycopene_cycl HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 19209964
NCBI-ProteinID: XP_007764259
JGI: Conpu1_79706
LinkDB All DBs
Position
Unknown
AA seq 643 aa AA seqDB search
MLRKTFAQAASRNLLRSTRAFSSTAPARRVVATNPVKAQEVSSWSNGKYPLIEHEYDAIV
IGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDT
VKGSDWLGDQDAIHYMCREAPHSVIELEHYGVPFSRTKEGKIYQRAFGGQSLKFGKGGQA
YRCAAAADRTGHALLHTLYGQSLRHNTNFFIEYFALDLIMQDGECVGVIAMNMEDGTLHR
FRAHKTVLATGGYGRTYFSCTSAHTCSGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCL
ITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPEKDHIYL
QLSHLPPEVLHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVLTTDE
NGNDKVVPGLYAAGEAACVSVHGANRLGANSLLDLVVFGRACAHHIKDTHTPGKPHKAIP
EEAGLDSVKFLDKIRNSDGPKPTAEIRLDMQKAMQSNAAVFRTQDVLDEGVQKVQSIYKS
FDQVGIKDRSMIWNSDLVETLELRNLLQCAVQTITAAAARKESRGAHAREDYPERDDETW
MKHTLTRQQDVNSPEVDITYRKVIHTTLDENECKSVPPFKRTY
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggaagacattcgcccaagcggcgtcgaggaacctcctgcgctcgacacgcgcc
ttctcgtccaccgcaccggctcgaagagtcgtcgcgactaaccccgtcaaggcccaggaa
gtcagctcgtggtccaacggaaagtatcctctcattgagcacgaatacgatgctatcgtc
atcggcgctggaggtgctggcctgagagccgcgtttggtctcgctgaagcaggcttcaac
accgcgtgtatcactaagctcttcccaactcggagtcacactgttgctgctcagggcggt
atcaacgctgcgcttggtaacatgactgaagatgattggcgttggcacatgtacgatacc
gtcaaaggttccgactggctaggtgaccaggacgccattcattacatgtgtcgtgaagct
cctcactccgttattgagcttgagcattacggcgttcctttctcgcgaacaaaagagggc
aagatctaccaacgcgcttttggtggccaatccctgaagttcggcaagggtggtcaagcc
taccgctgcgcagctgctgctgatcgtactggtcatgcccttctgcacaccctttacggc
cagtctctccgtcacaacaccaacttcttcattgaatatttcgccctcgacctgatcatg
caagacggcgagtgtgttggtgtgattgccatgaacatggaggacggtacccttcaccgc
ttccgtgctcacaagaccgtcctagcaactggcggttacggacgtacctacttcagctgc
accagtgcgcacacctgctctggtgatggtaacgccatggttgcccgcgccggccttccc
ctgcaggatcttgagttcgttcagttccaccctactggtatctatggtgccggttgtctt
attactgaaggttctcgtggtgagggtggatacctcttgaactcggagggtgagcgcttc
atggagcgttacgcgcctacggccaaggatcttgcttcccgtgacgtcgtctctcgttcc
atgactattgaaattcgcgagggccgtggtgttggaccggagaaggatcacatctacctc
cagctcagccacttgcctcccgaagtccttcacgagaggttgcccggtatctctgagact
gctgctatcttctccggtgtcgatgtcaccaaggagcctatccctgtcctgcctactgtt
cactacaatatgggtggtatccctactaagtacaccggtgaggttctaactactgacgag
aatggcaacgacaaggtcgtccctggtctctacgccgctggtgaggctgcttgcgtctcc
gttcacggtgccaaccgcctgggagccaactccctactcgatcttgtcgtgttcggtcgc
gcctgcgctcatcatatcaaggatactcacacgcctggcaagcctcacaaggccatccca
gaggaggctggtctcgatagcgtgaagttcttggacaagattaggaactcggacggcccg
aagcccaccgctgagatccgtctggacatgcagaaggccatgcagtctaacgccgctgtg
ttccgcacacaggatgtccttgatgagggtgttcagaaggtgcagtcgatctacaagtcc
tttgaccaggttggtatcaaggaccgcagcatgatttggaactctgatcttgtcgagacc
cttgagctacgcaacctcctccagtgcgctgtccagactatcactgccgctgctgctcgc
aaggagtctcgtggcgctcatgctcgtgaagactaccctgagcgtgatgatgagacctgg
atgaagcacactctgacccgccagcaagacgtcaactcgcctgaagttgacatcacgtac
cggaaagtcatccacaccaccctcgatgagaatgagtgcaagtctgttcctccgtttaag
cgtacttattag

DBGET integrated database retrieval system