KEGG   Coniophora puteana: CONPUDRAFT_83027Help
Entry
CONPUDRAFT_83027  CDS       T03134                                 

Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cput  Coniophora puteana
Pathway
cput00020  Citrate cycle (TCA cycle)
cput00480  Glutathione metabolism
cput01100  Metabolic pathways
cput01110  Biosynthesis of secondary metabolites
cput01130  Biosynthesis of antibiotics
cput01200  Carbon metabolism
cput01210  2-Oxocarboxylic acid metabolism
cput01230  Biosynthesis of amino acids
cput04146  Peroxisome
Module
cput_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CONPUDRAFT_83027
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CONPUDRAFT_83027
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CONPUDRAFT_83027
Enzymes [BR:cput01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CONPUDRAFT_83027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 19210513
NCBI-ProteinID: XP_007770045
JGI: Conpu1_83027
LinkDB All DBs
Position
Unknown
AA seq 450 aa AA seqDB search
MQRATLFGSVRRSYVSGRSAFALSRGFATSMRTLDGSKIVVTKPVVELDGDEMTRIIWKK
IREELILPYLQLDIKYFDLGLEYRDQTNDQITVDAANAIIEHKVGIKCATITPDEARVEE
FKLKEMWRSPNGTIRNILGGTVFREPIILKRVPKPVPGWVNPIVIGRHAFGDQYRSTDFV
APGPGKLQLVYTPADGGAPTTMNVYDFKGKGVAMSMYNTDESITGFAHASFKMALSKKMP
LFMSTKNTIMKKYDGRFKDIFQEIYDKEYKPLYEAAGIYYEHRLIDDMVAQAIKSSGGFV
WACKNYDGDVQSDILAQGFGSLGMMTSELITPEGDIIESEAAHGTVTRHYREYQKGNETS
TNPVASIFAWTRGLLHRAKLDNNDPLRKFCLDLEAACVEVIDGDGIMTKDLALAIYGKAM
KREHWVVTDKYMDAVKAKLQEKMAARGAKL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcgccacgctcttcggctctgttaggcgttcgtatgtctctggacggtcggct
tttgctctttccagagggttcgcaacgtcgatgaggacgctggacggaagtaaaatcgtg
gtcaccaagcccgtcgtcgagctcgatggagatgagatgacgcgcatcatctggaagaag
atccgagaagaactcatcctgccgtatctccaactcgacatcaagtactttgatcttggc
cttgaataccgcgaccagacgaacgatcagatcaccgtcgacgccgcgaatgctatcatc
gagcacaaggtcggcatcaagtgcgcgactatcacccctgatgaggcacgggtggaagag
tttaagctcaaggagatgtggaggagtcccaatggaacgatccgtaatattcttggtgga
accgtttttcgcgagcctatcatcctgaagcgcgtcccgaagcctgttccaggctgggtg
aatcccattgtcattggtcgtcatgcgttcggtgaccagtaccggtcaacagattttgtc
gcccctggacctggtaaactccagttggtttacacccctgctgatggcggcgcaccaacg
actatgaatgtttatgacttcaaggggaagggtgttgccatgagcatgtacaacaccgac
gagtcgataacaggcttcgcgcatgcatcgttcaagatggcactatcaaagaagatgcct
ttgttcatgtctacgaagaacaccatcatgaagaagtacgatggacgtttcaaggatatc
ttccaggagatttacgacaaggaatacaagcccttgtacgaggccgctggcatctactat
gaacaccgtcttatcgatgacatggttgcccaagccatcaagtcctcaggcggcttcgtc
tgggcttgcaagaactacgacggtgatgttcagagtgacatcctcgctcaaggtttcggc
agtctcggcatgatgacctccgagctcatcactccggagggtgacattatcgagagcgaa
gccgcacacggcactgtgacgcgccactaccgcgagtaccagaagggcaacgagacctcg
acgaaccccgtggcgtccatcttcgcgtggacccgtggtctgcttcaccgcgccaagctt
gataacaacgacccgctgcgcaagttctgccttgatctcgaggcggcttgtgtggaggtt
attgacggggatggcattatgaccaaggaccttgcccttgcgatctacgggaaggcgatg
aagcgcgaacactgggttgttaccgacaagtatatggatgccgtcaaagctaagttgcaa
gagaagatggctgctcgcggtgcaaagctctga

DBGET integrated database retrieval system