KEGG   Coniophora puteana: CONPUDRAFT_83539Help
Entry
CONPUDRAFT_83539  CDS       T03134                                 

Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
cput  Coniophora puteana
Pathway
cput03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cput00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    CONPUDRAFT_83539
Enzymes [BR:cput01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CONPUDRAFT_83539
DNA repair and recombination proteins [BR:cput03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     CONPUDRAFT_83539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C RNA_ligase BRCT LIG3_BRCT DUF4073 PTCB-BRCT
Motif
Other DBs
NCBI-GeneID: 19210610
NCBI-ProteinID: XP_007770950
JGI: Conpu1_83539
LinkDB All DBs
Position
Unknown
AA seq 992 aa AA seqDB search
MQATPAPSPPRNENGQAATSYPAPPRNVDSAPFSILSRLFDKLSAERRPERRRKFLDVWF
NHWKEDIGYDLYPVLRLILPQRDRERAVYGLKEKNLAKTYIKLIPLNMKDPDAIRLLNWK
KPTDRDRSSGDFPTVLYEVVNKRSSVTEGSLTVEDLNNILDELSKNMGKQEVQSKILQRI
YNRATPEEQRWIVRIILKDMVISVKETTVFSVFHSDAQDLFNTCSDLKKVAWELWDSSRR
LNPEDKSVQLFRAFAPMLCKRPTDRIDETVKEMQGRKFIIEEKLDGERMQLHKRGNEYFY
CSRKGKDYTYLYGQHVGNGSLTPYIHSAFDERVDDIILDGEMLVWDPVSERNLPFGTLKT
AALDKTNKEHNPRPCFKIFDLLYLNGMSLHKKSLKFRKRNLRACLTEVPGRLEFTVEYEG
KTAKDIRQKMEEVMSARGEGLVIKHPDSEYTLNGRNRDWIKVKPEYMDNLGETVDVLVVA
ANYGTGKRSGGVSTLICAVLNDRQPDDDDEPKYSSFVRVGTGLSFTDYIWVRQKKWKPWT
AEDPPTFYQTSKRGQEDKGDMYIEPHDSFIVKIKAAEITASDQYHMGMTMRFPRILSIRD
DLGIEDCMTASEVLESMQVERKRKMEGNTGVSNKKRKTMTAKKASILPEYHGPDLKSVEL
ESDVFEDMRFMVSSDPKSRTGSEDREELMKIIHANGGQCVQVVGSQPTIVVYGGTTTPYD
LKLLINKGTVDIVKPEWIHDSVSRGQLAPMAKRYLFHATHERQLDPDFDQDEDVMEEDKP
NADDILQSHATPASAKKEESQVKDEVNKDNDSGDWLKVNADAEDEEGSVTESETDDDSVN
DDVISEGEDIDSTEAAPAGRTLDDTSREHVVMGENDDAMQYDDTHIFKHLCFYLDSPAIA
RKKGMTVKTKHEEEVARSFTILASQIEDNGGGIVELDDPKLTHVVLDKRDTSRRLTLNER
TSKPKRRRLVLADYISACLAEETLLDEEEFAP
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctaccccagcgccatcgccacctcggaatgagaatggccaggcagcaacgagc
tacccagctccaccccgaaatgtcgatagcgctcccttttcaatactgtcgcgtctgttc
gacaagctctcggctgagcgaagacctgaaagaaggaggaagtttcttgacgtctggttc
aaccactggaaagaagacatagggtatgacttgtatcccgttctgcgcctcattctgcca
cagagggatagggagcgtgcagtgtacggtttaaaagaaaagaacctcgcgaagacgtac
ataaaactgatacctttaaacatgaaggaccccgacgccatccgcctcctcaactggaag
aagcctaccgatagagataggagctccggagattttccaacagtactctacgaagtggtg
aacaagcgatcttctgttactgagggctcgctgacagtcgaggatctgaacaacattctg
gacgaactctcaaagaacatgggcaagcaggaggtacagtcaaagatcctgcagcgaatt
tacaaccgcgccacacctgaagagcagcggtggatagtccgtattatcctcaaggacatg
gtcatctctgtgaaggagacaacggtgttttctgttttccattcagatgcccaagatctc
ttcaatacttgttctgacctcaagaaggttgcttgggagctgtgggattcatctcgacgt
ctcaaccctgaggacaagtctgttcagctgttccgcgcatttgctccaatgctatgcaaa
agacccaccgacagaatcgacgaaaccgtgaaggaaatgcaaggacgtaagtttatcata
gaggaaaagctagacggcgagcgtatgcaacttcataaacgggggaatgaatacttctac
tgctccagaaaagggaaagattatacctatttgtatgggcaacatgttggcaatggcagc
ttgaccccgtacatacattctgcttttgatgagcgggttgacgatatcatcctcgacggc
gagatgctagtgtgggatcctgtttcggagcgtaacttgccgtttggtactctcaaaact
gccgctcttgacaaaacaaacaaggagcataaccctcgtccctgcttcaagatttttgac
cttctttatctcaacgggatgtctcttcacaaaaaatcactcaagtttaggaaacgtaac
ctccgagcttgcctcacagaggttcctgggcgactcgagttcacagtagagtatgagggg
aagaccgccaaagatatccggcaaaagatggaagaagtcatgtctgcgaggggcgagggc
ctggtaattaagcatccagactctgaatatactctcaatggcagaaacagagattggata
aaggtcaagccagagtatatggacaacttgggagagactgtggacgttctagtagtcgct
gcaaattatgggaccggaaagcggtccggaggtgtctctaccctcatctgtgctgttcta
aacgaccgccaaccagacgatgacgatgagccaaagtatagctcctttgttcgggtagga
actggcctgtcattcactgattacatttgggtgcggcaaaagaagtggaagccttggacg
gcagaagatccacccacattctatcagacttctaaacgggggcaagaggacaagggcgac
atgtacatcgaaccacatgactcattcatagtcaagattaaggcagctgagatcacggca
tccgatcaatatcatatgggtatgaccatgcgctttccccgtatactatctatacgggac
gatcttgggattgaagattgcatgacggcttcggaggttcttgagagtatgcaggtggaa
agaaagcgcaagatggaggggaatacgggggtgtcaaacaagaagagaaagacaatgaca
gctaagaaagcttccatattacccgagtaccatgggccggatcttaagtctgtcgaattg
gagtctgacgtattcgaagatatgagattcatggtctcctctgatccaaagtctaggact
ggtagtgaagatagggaagagttgatgaaaatcatacatgccaatggtggacagtgcgtt
caagttgtgggttctcagccgaccatcgtcgtttacggaggaacgacgacaccatacgac
ctcaaactcctcattaacaaaggcacagttgatatcgtcaagccggaatggatccatgac
tctgtctcccgcggacagttggcccccatggccaaaagatatctcttccatgccacccac
gagcgacaactcgacccagactttgaccaggacgaggatgttatggaagaagacaaacca
aatgccgatgatattttacagtcccatgccactccggccagcgcgaagaaagaggaaagc
caagtgaaggacgaagttaacaaagataatgattcaggagattggctcaaagttaacgct
gacgccgaagacgaggaaggctcggtcaccgagagtgagacagacgatgattctgtgaac
gacgacgtcatctccgagggagaggatatcgactcgacagaggctgctcctgccggaagg
actctggatgatacatcccgggaacacgtagtcatgggcgaaaatgacgacgccatgcaa
tacgacgatacgcatatttttaagcacctgtgtttctatttggattcaccagcaattgct
cggaagaaagggatgacggtcaagaccaagcacgaggaagaagtagcacgcagcttcacc
atcctagcatcccaaatcgaggataacggcggagggattgtcgagttggatgaccctaag
ttgacgcatgtagtcttggacaagagagacacatcccggcgattgactctcaacgaacgt
acatcaaaaccaaagcgaaggcgcttggttttggccgattacatatccgcttgccttgcg
gaggagacgctgctggatgaggaggagttcgcaccctag

DBGET integrated database retrieval system