KEGG   Coniophora puteana: CONPUDRAFT_93569Help
Entry
CONPUDRAFT_93569  CDS       T03134                                 

Definition
(RefSeq) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
cput  Coniophora puteana
Pathway
cput00260  Glycine, serine and threonine metabolism
cput00630  Glyoxylate and dicarboxylate metabolism
cput00670  One carbon pool by folate
cput01100  Metabolic pathways
cput01110  Biosynthesis of secondary metabolites
cput01130  Biosynthesis of antibiotics
cput01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CONPUDRAFT_93569
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CONPUDRAFT_93569
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CONPUDRAFT_93569
Enzymes [BR:cput01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     CONPUDRAFT_93569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-GeneID: 19211591
NCBI-ProteinID: XP_007774728
JGI: Conpu1_93569
LinkDB All DBs
Position
Unknown
AA seq 392 aa AA seqDB search
MPTVLLAGLRQPLDLWLRRTGLYDFHVENGAKMVPFAGFEMPLAYGNVGQVASHTHVRTS
AGLFDVGHMVQSMFRGPTATEFLEWLTPSSLGGLAPYSSTLSVLLNERGGIIDDTVITKH
AKDAFYVVTNAGRRDADMAWFKERLEEWNTERGGKGGGKVEWEVLDGWGLVALQGPESAG
YLQALTSFDLKGLTFGRSAFVPVEGFNLHVARGGYTGEDGFEISIPPQHTETVTRLLTKS
PVQLAGLGARDSLRLEAGMCLYGQDLDEDTTPVEAGLSWVIGKDRRENASFIGAQGVLKH
LKEGPPRRRVGFVVEGAPARQGAKLFTPGGEASIGTITSGIPSPTLGKNIAMGYVTSGNH
KKGTEVEVEVRNKRRKAIVTPMPFVKPNYYRG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcccacggtactgctcgcgggcttgcgacaaccactggacctgtggctccgtcgtacc
ggtttgtatgactttcatgttgagaacggggcaaagatggtgccgttcgcagggttcgag
atgcccctagcgtatggtaatgttgggcaagttgcaagccacacccatgtgcgcacgagc
gcgggcctgttcgacgtcggacacatggtccagtccatgttccgcggcccaacagcgacc
gagttcctcgaatggctcaccccgtcctcgctcggtgggctcgctccgtactcctcaacg
ctgtcggtgctgcttaacgagcgcggcgggatcatcgacgacactgtcatcaccaagcac
gccaaagacgcgttttacgtcgtcaccaatgccggccgtcgcgatgcggacatggcgtgg
tttaaggagagattagaggagtggaatacggaaaggggcgggaaggggggaggcaaggtg
gagtgggaggtgttggacgggtgggggctcgttgcgctgcaggggccggagtcggcgggt
tatttgcaggctctgacgtcgttcgacctaaaggggcttactttcggtcggtcggcattc
gtccccgtggagggtttcaaccttcacgttgcccgaggcggatacacgggtgaagacggt
ttcgagatctcaatacccccgcaacataccgagaccgtgacccgcctgctaaccaagtcg
cccgtgcaactcgccggcttgggggcgcgcgactcgctccgtctcgaagcgggcatgtgt
ctgtatggtcaagatctcgatgaggatactacgcccgtcgaggccggtctctcatgggtc
attggcaaagataggcgcgaaaatgcgtctttcattggcgctcagggcgtattgaagcat
ctgaaggaaggaccacctagaaggcgcgttggattcgtagtcgagggagctcctgccaga
cagggtgcgaagctgttcaccccgggaggcgaagcgtctatcggcactatcacatctggg
attccctcacccaccctcggcaagaacatcgcgatgggctacgtcacgtccgggaaccac
aagaaggggaccgaggtcgaagtcgaggtgcgcaacaagcggagaaaggcgatcgttacg
cccatgccgttcgtcaagccaaactactaccggggatga

DBGET integrated database retrieval system