KEGG   Cryptosporidium parvum: cgd2_210Help
Entry
cgd2_210          CDS       T00168                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00006  glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
cpv  Cryptosporidium parvum
Pathway
cpv00564  Glycerophospholipid metabolism
cpv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    cgd2_210
Enzymes [BR:cpv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     cgd2_210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_Gly3P_dh_N NAD_Gly3P_dh_C
Motif
Other DBs
NCBI-GeneID: 3372365
NCBI-ProteinID: XP_625390
ApiDB_CryptoDB: cgd2_210
UniProt: Q5CPN1
LinkDB All DBs
Position
2
AA seq 416 aa AA seqDB search
MCLRQHLRCSSLKVTIFGAGSFGSAISCVVGYNTERTLIFNSEVKLWLYDERLESGEYLA
DVINRDHVNVKYLPDFKLPNNIRAVTDLKEACEDCNLMIFVIPSQFIRSVASQIRKLDID
FSRAVRAVSLTKGFLVENGHPFLISKIIEEELGIDCCVLSGANVASGLAAKEFGEATLAC
SDYDDAYIWQYLFDTPWFKIDCVPDVICTELFGGLKNIIALLVGMIQGLGCGTNTVAAVM
RLGVLEMILYGSIFFNIRSSIMTRVFFESCGIADLVTTCLGGRNVRGGKAFTLSNGQKPW
EEIEAEVTGGQHLAGLVTLKEINETLEVLLIEKSIDVDKHFPLFRSCFKIAYTGAPPRSL
IDILGRNELRELRFVPSGLLSLIDDSPNHGEVMQRSSSRQVGSLILSKTQSCMQYE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttaagacaacatcttcgttgtagttcattaaaagtaaccatttttggtgcagga
agctttggatcagcaattagctgtgttgtagggtataatactgaaaggactttaatattt
aacagtgaagtaaaactttggctatatgatgaacgacttgaatcaggagagtacttagct
gatgttattaacagagatcatgttaatgtcaaatatttaccagatttcaagctacctaat
aatatcagagctgttactgatttaaaagaagcatgtgaagattgcaatctaatgatattt
gtcattccaagccaatttatacgctctgtggcatcccaaattagaaagctagatattgac
ttttctagagctgttagagctgtatcattaacaaaaggttttcttgttgagaatggccat
ccatttctaattagtaaaattattgaagaagaattgggaatcgattgttgtgttctttca
ggagcaaatgtagcttcaggattagcagctaaggagtttggtgaggcaactttagcttgc
tctgattatgatgatgcttatatttggcaatacttatttgatactccttggttcaaaata
gattgtgttcctgatgttatttgtactgaactttttggaggattaaaaaatattattgca
ttacttgtaggtatgatacaaggtttaggatgtggtacaaataccgttgcagctgttatg
agattaggagtacttgaaatgattctatatggaagtattttctttaatattagaagttct
attatgactagagttttcttcgaatcatgtggtattgctgacctagtcaccacttgttta
ggtggaagaaatgttaggggaggtaaagcttttacattatcaaatggtcagaagccctgg
gaagaaattgaagctgaagtaacaggaggtcagcatcttgctgggcttgtaactcttaag
gaaattaatgaaactcttgaagttttattgattgagaagtctattgatgtagataagcat
ttcccgctttttagaagctgctttaagattgcatatactggtgctcctcccagatcattg
attgacattctaggaagaaatgaactgagagagcttaggttcgttccatctggactcctt
tccctaattgacgatagtccaaaccatggagaagtcatgcaaagatcttcctccagacaa
gttggctctcttattttatctaaaacacaaagctgtatgcaatatgaataa

DBGET integrated database retrieval system