KEGG   Cryptosporidium parvum: cgd2_4190Help
Entry
cgd2_4190         CDS       T00168                                 

Definition
(RefSeq) DEXDc+HELICc, mus308/POLQ like SFII DNA helicase, no polymerase domain
  KO
K02349  DNA polymerase theta [EC:2.7.7.7]
Organism
cpv  Cryptosporidium parvum
Brite
KEGG Orthology (KO) [BR:cpv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cpv03400]
    cgd2_4190
Enzymes [BR:cpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     cgd2_4190
DNA repair and recombination proteins [BR:cpv03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   DNA polymerases
    cgd2_4190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C
Motif
Other DBs
NCBI-GeneID: 3373484
NCBI-ProteinID: XP_626598
ApiDB_CryptoDB: cgd2_4190
UniProt: Q5CT71
LinkDB All DBs
Position
2
AA seq 1154 aa AA seqDB search
MNQELIEVHEIKELLDLDLYDSQLFSEIQEEDESMIEDLAGMSDHYEESGAEDISNIIQN
LEEIMKDELIDSNLVSDDAEILADLLNETGEANMELDDNNLFIQNKVDSFENQVGNSLQS
LGIDERLVKYYSEKGLRNLYDWQYECITQPGVLQGRNLVYSAPTSGGKTLVSELLMYKRV
LEGGRAALVVFPFVSLVSEKRDSYYKAGGEVCGLRISEFHYGSKSPLFEEFDIGVATIEK
ANALISYYIQHGILFKRLGIIIVDELHLLGDEQRGYILEVMLTKVRLLSKLQGEGRTIQI
VGMSATLPNLRDIGLWLDAVVYQSNFRPVPLREHIVIKGKAYIKPGKDQNKSTLGSSVQD
TLSKVMSWDFHQVNSKFNSTDFDIDQIGSSRWKYPIVDMSELLVIGWEALKKGESVLVFC
PSKYSVESTALFFANCIKRQFCEGIDIENCSNRQQIMQSLRSVERQRYMLAEEIRQNSSL
SKRSIQNNNTLIDCIVKGIGFHHSGLSHIERRIVEKGYRNGILSLLTATSTLAAGVNLPS
KRVIFRGINIGKSFLTCVDYKQMSGRAGRAGQKGAFGESFILVNETLSQPGREVSEEVEN
ALGLITADMKPLMSSFFTNTNGITRLILEILAVLFEFDQNISVNNKEKIPDKGSHTGSIL
DLLTESTLMSYQIKLYNDLSHEYLKNIDALERALSYLLEKKMIMNREKKTNPISIGGYTL
NCCCTQLGKAIVSSGLSPSTGLELYDELRRNMESTFLGDLTYMSYLVTPFPPNEISNGSK
PTSTSTQPFFRLDWKVLYDNIKEMTILERHSLIRLGFDLEQISWASQLCEDNLPPKLKEP
EFLRRHQRLFASQIMKSILNGLSTEVILSKFKFISVRDLQQLHTGVLSMCISCISFCQNM
NWSNMQIVFQSYLRQLQTITLLEEYSGTLTKDQNLEKSVKKLISGVKGLSFLSALELRST
LSVKTPNQFLTIPKKILTQMINNRVYSGGIKTLQFVNHFVNKVFIDMQNSKKIPFYNRSL
GFSNISPNLIFQTIHTIPDLEKDENLNILNFSEKQLNEIENSCILEALSEWDSFGQQSKP
DDNNHISYTSQDIPELTGCDMNNFDFENDDEILDMLQDDIQDNIDLEERLLLWSTPLQQS
QDWESQGNWKLNNK
NT seq 3465 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagaattgattgaagttcatgaaataaaagaattattggatttagatttatat
gatagccagttattcagcgaaattcaggaagaagatgaatctatgatagaggatttggct
gggatgagtgaccattatgaggagagtggggcagaagatataagtaatattattcaaaat
ttggaggaaattatgaaggatgaattgattgattctaacttggttagtgatgatgcagag
atcctggcagatctcttgaatgagacaggcgaagccaacatggagcttgacgataacaat
ttgtttattcaaaataaagtagacagttttgaaaatcaggtaggtaattctttgcaaagt
ttaggaatagatgaaagattagtaaaatattactcagaaaaaggcctaaggaatctttat
gattggcagtatgagtgtattacccagcctggagtactacaaggcagaaatttggtatat
tctgctccaacaagtggaggcaaaactttggtaagtgagttgctaatgtataaaagagtt
ctagaaggtgggagagcagctttagtagttttcccatttgtatctttggtatcagagaaa
agggatagttactataaggctggaggagaagtgtgtggacttagaattagtgaatttcac
tatggaagtaaaagtccgctttttgaagaatttgacattggtgtagcaactatagaaaag
gcaaatgcattgattagttattatattcagcatggaatattatttaagagattgggaatt
attattgtagatgaattacacttacttggggatgagcaaagaggatatatactcgaggtg
atgctaacaaaagtgagactattgagtaagttacaaggcgagggaagaacaatacaaata
gtgggtatgagtgcaacattaccaaatctaagagatattggcctttggttggatgcagta
gtttaccagagtaattttcgtccagttccactcagggaacatatagtaatcaaaggcaag
gcatatattaagccaggaaaggatcaaaacaaaagtacattagggtcttccgtacaagat
acattaagcaaagtaatgagttgggactttcatcaggttaattctaagtttaattcgaca
gattttgatattgatcagattggttctagtagatggaaatacccaatagttgatatgagt
gagttgttggtaataggatgggaggctttgaaaaaaggagaaagtgtactagtgttttgt
ccttcaaagtactccgttgagtctacagctttgttttttgctaattgcataaaaagacaa
ttttgtgaaggaattgatatagaaaattgttcgaataggcaacagattatgcagtcttta
agatctgttgagaggcagagatatatgttagctgaagaaattaggcagaactcctctctt
tcaaaaagatctattcaaaacaataacactcttattgattgcatagtcaaagggatagga
tttcaccattctggtttatctcatattgaaagaagaatagttgagaaagggtatagaaat
ggtatcttgtctttactaacagcaacttcaactttagcagctggagtcaatcttccttca
aaaagagtcatcttcagaggtatcaatattggaaaatcttttttaacgtgtgttgattac
aaacaaatgtcaggaagagctggtagagctggccagaaaggagcttttggtgagagcttc
attctcgtaaatgagactctatcgcaaccagggagggaagttagtgaggaggttgaaaat
gcattagggcttattactgcagatatgaaacctttgatgagttctttctttactaatact
aatggaattaccaggctaatcttagaaatacttgcagttctatttgagtttgatcagaat
atatccgtgaataataaagaaaaaattccagataaaggatcacatactggctcaattttg
gacttgttgacagaatctactttaatgtcttaccaaattaagctttacaatgacttatct
cacgaataccttaagaatattgatgcattagaaagagctttaagctatttacttgaaaag
aagatgataatgaatagggagaaaaaaacaaacccaatttcaattggaggttatacactg
aattgttgctgtactcaattgggaaaagctattgtttcttcaggtttatctccttccaca
ggtttggagctatatgatgaacttagaagaaatatggaatcaacttttttaggagatttg
acttatatgtcctacttggtgactccttttcctccaaatgaaatatcaaatggatccaaa
cccacatctactagtactcaaccattctttagattggattggaaagttctttatgataat
attaaagaaatgacaattttagaacgtcattcattgattagacttggctttgacttagag
cagatttcttgggcttctcaactatgcgaagataatctcccaccaaagcttaaagagcca
gagtttctaagaaggcatcaaagattatttgcatcacagattatgaaatcaattttgaat
ggattatcaacggaagttattctttcaaagttcaagtttatatctgttagagatcttcaa
cagctccataccggagttttgtcaatgtgtatttcatgtatatcattttgtcagaatatg
aattggtccaatatgcagattgtttttcaaagttaccttagacaacttcaaacaattaca
ctattagaagaatattctggaactttgacaaaagatcaaaatttggagaagagtgtcaaa
aaactaatttctggagtgaaaggtttatctttcttgtcagcattagaactaagatcaaca
ctttctgtgaaaactcccaatcaatttttaacgataccaaagaaaattcttacacaaatg
atcaataatagagtatattctggaggaatcaaaacattgcaatttgtaaatcattttgtt
aacaaagttttcattgacatgcaaaattctaagaaaattcctttttataatagatcttta
ggattttcaaatatttctccaaatttgatttttcaaaccattcatactattccagatctt
gaaaaggatgagaacttaaacattttgaacttcagtgaaaaacaactgaatgagattgaa
aatagttgcattttagaggctttgtcagaatgggattcatttggccaacaatccaagcca
gatgataataatcacatatcttacactagtcaagacattcctgaattaacaggatgtgat
atgaacaatttcgactttgaaaatgatgatgagattctagacatgctacaagacgacatt
caagacaatattgacttagaagagagacttttgctttggtcaactccattacaacaatcc
caagattgggaatcacaaggtaattggaaactaaacaataaatga

DBGET integrated database retrieval system