KEGG   Cryptosporidium parvum: cgd4_690
Entry
cgd4_690          CDS       T00168                                 

Definition
(RefSeq) pyruvate:ferredoxin oxidoreductase/NADPH-cytochrome P450 reductase PNO
  KO
K21682  pyruvate dehydrogenase (NADP+) [EC:1.2.1.51]
Organism
cpv  Cryptosporidium parvum
Brite
KEGG Orthology (KO) [BR:cpv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    cgd4_690
Enzymes [BR:cpv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.51  pyruvate dehydrogenase (NADP+)
     cgd4_690
SSDB
Motif
Pfam: POR_N FAD_binding_1 POR Flavodoxin_1 EKR NAD_binding_1 PFOR_II Fer4 Fer4_7 Fer4_16 TPP_enzyme_C Fer4_10 Fer4_21 Fer4_9 Fer4_2 Fer4_6 Fer4_8 Fer4_17 Fer4_18 Fer4_13 Flavodoxin_5
Other DBs
NCBI-GeneID: 3372747
NCBI-ProteinID: XP_625673
ApiDB_CryptoDB: cgd4_690
UniProt: Q5CQH5
LinkDB
Position
4
AA seq 1934 aa
MGEKEIVDGCVAACHIAYACSEVAFTYPITPSSTISEVADSWMSRGRRNIFDQVVSVVEM
QSEMGSAGALHGSLSVGCSTTTFTASQGLLLMIPNMYKIAGELWPCVFHVTARAIATSSL
SIFGDHNDIMAARQTGWAFLGAMTVQEVMDLALVSHVSTFECSVPFVNFFDGFRTSHELQ
KIDMISYETIKKIFPYEKLKEFRERALNPTHPTLRGTATSSDVYFQLAEARNKYYESTPD
IVQSVMDRLAKLIGRSYHLFDYYGHPDAEFLIVVMGSGGLTIEEMIDYLMEKSNEKVGMI
KVRLFRPWSIDAFVKKIPKTTKRITVLERCKESGSLGEPLCLDVSTSIMRSELSSNNILV
LGGRYGLASKEFTPGMALAVWENMISEKPINNFSVGIDDDVTFKSLFVRQPRLDLLTSET
KQCLFWGLGSDGTVSANKNAIKIIGESTDLQVQGYFAYDAKKAGGATMSHLRFGPKPIKS
AYLLQRCDYVAVHHPSYVHKFDVLENIKQGGCFVLNCPWSTLEELNHELPSKIKHQIASR
DVKFYVIDAQRIAQESNLGRRINNILMVVFFSLTNIIPLDLAIKLVKEAIKKTYGKKGDA
VVNSNWKAVDLTLESLIQISYDKSQWISKDKCGEKSLPATAVETGNKDQEITKSTVLKQK
PEHDVNQFVKDILGPVNALKGDELPVSMFDPTGTVPLGTTAYEKRGIAMSIPIVDMNKCT
QCNYCSIVCPHAAIRPFLLDEAEFKNAPETMHIPKAKGGQEFSSYYYRIQVTPLDCTGCE
LCVHACPDDALHMEGLQKMEAVEKTHWDYLIGLPNKAEKFDRTTVKGSQFQQPLLEFSAA
CEGCGETPYVKLLTQLFGERMVIANATGCSSIWGASYPSVPYTKNQKGYGPAWGNSLFED
NAEYGLGMVVGYRQRRDRFRELVSNEILKDITEEEEFLKDDNASVQGRNEIITKYDHLKD
YLRSWLKNIRNGEACQSLFEEISKLLEDNLINSNNFAQVLKKDRIELLEKLYDSRDLIPK
ISHWIVGGDGWAYDIGYAGLDHVLSFGEDVNIIILDTEVYSNTGGQASKSTPFGAIAKFA
QSGNLRQKKDIGSIAMEYGSVYVASVALGANYSQTIKSLLEAEKYPGTSLIVAYSTCIEH
GYTKYNLQQESVKLAVESGYWPLYRYNPELVRTEVVDNLTTIVSSGFTLDSKKVKVDIEN
FLKRENRFLQLIRSNPELASMAKDKLKAHSDKRFQKMKDMSENVTVTALKDQIKKLKDQL
ISIQNASKTGELAASGLINADLFIEQEMHVLYGTETGNSEEVAQYIQSQLVSRGYSSSSL
NLDDLDIDEFLNPDKFSTVIIVTSTSGQGEFPGSSGILYEALLKKHLENQDDKFCSFMRF
GIFGLGDSNYVFFNEAAKKWDKLLLDCGAVRIGAVGMGDDQSEEKYETELIEWLPDYLQL
INAPEPKHDEKSEIPKATTFKVTILDSCRNDILNESTGTLCEKLDENNNIGNSHYKPIIP
PNSVLLPVIENKRITNQDYDKDVRHIVFKLIGDGGDTPSLSYCLGDSLALYGQNPVNEAI
KAIEMFGYNPYSLLRLSINEENEANNTNKVNQRYSSLFGYDITVLQLFVECLDLWGKPNR
KFFQEFYRYCSNPEEKIQAKKWAQNEGKKLIEEFSSKTGTYLDVFKMFESARPTLAQLLD
IVPFIKSRSYSIASCNKFVNGEKIELCVGIVDWKLESGEIRYGQCTGFLNRLPILDSESK
IDSIPRLPSNIKASAFNLPFDYRSPVIMACMGTGIAPFRAFVQNKKYIRDVLKEEIGPVI
LYFGCRYYDNDYLYREELENYVKEGVITSLNIAFSRDPKGYKTSNCENIRYAQKMYVQHL
MLENSQEIYENMIEKCGYFYLCGTKQVPIDIRKAIIQIIIKHSSTTEQVTSEEDANSILN
SIQIMGRYNVEAWS
NT seq 5805 nt   +upstreamnt  +downstreamnt
atgggtgaaaaagaaatagtagatgggtgtgtagctgcttgccacattgcatatgcttgc
tctgaggtggcatttacatatccaatcactccctctagtacaatttctgaggtcgcagac
tcatggatgtctcgtggacgacgaaatatttttgatcaagttgtatcagttgttgaaatg
cagagcgaaatgggttctgcaggcgcattacatggatctttgtctgttggttgctccaca
acaacttttactgcttcacaagggttattgttaatgattccaaatatgtacaaaattgct
ggtgagctttggccatgcgtatttcatgttacagccagagctatcgctacatcttcactc
tctattttcggagaccacaatgatattatggctgccagacaaactggctgggcttttttg
ggagctatgacagtacaggaagttatggatttggcattggtctcacatgtgagtacattt
gagtgtagcgttccctttgttaacttctttgatggattcagaacatctcacgaattacag
aaaattgatatgattagttatgaaactattaagaagatttttccatatgaaaaacttaaa
gagttcagagaaagagcattaaatccaacacacccaactctaagaggtaccgctacaagc
tcggatgtctattttcaacttgctgaggcaagaaataaatattacgaatctactccagat
attgttcagagtgttatggaccgtttggctaaattgattggtagaagctatcaccttttt
gactactatggccaccctgatgctgagtttttaatcgttgtaatgggttcaggcggtctc
acaattgaggagatgattgattatctaatggagaagagtaatgaaaaggttggcatgatc
aaggttaggctttttagaccttggtctattgatgcttttgttaaaaagattccaaagact
acgaaaagaattactgttttggaaaggtgcaaagaaagtggctctcttggtgaaccactt
tgtctggatgtatctaccagcattatgagatccgaactttctagtaataatattttggta
ttaggtggaagatatggtctagcaagcaaagagtttactccaggaatggctttagcagtc
tgggaaaacatgataagtgaaaaaccaatcaataatttctctgttggaattgatgacgat
gtcacatttaaatctctctttgttaggcaaccaaggttggatttacttactagcgaaact
aagcaatgcctcttttggggtctcggctctgatggtaccgtttctgctaataaaaatgct
atcaagatcattggagagtctacagatcttcaggttcagggttactttgcatatgatgca
aagaaagctggcggagctaccatgagccatcttaggtttggcccaaaacccattaaatct
gcctatttacttcaaagatgtgattatgttgcagtacaccacccatcatatgttcacaag
tttgatgtattagagaatattaagcaaggtggttgcttcgtacttaattgcccttggagt
acattggaggagcttaatcatgagcttccttcgaagatcaaacatcaaattgcatctaga
gatgttaaattctacgttattgacgctcaaaggattgctcaggagtctaatcttggaaga
agaattaataatatacttatggttgtctttttcagtttgacaaatatcattcccttagac
ctcgcaattaagcttgtaaaggaagcaattaaaaaaacatacggaaaaaagggagatgct
gttgttaattccaactggaaggctgttgaccttaccttagagtctttgattcagatatcg
tatgacaagtctcagtggataagcaaagacaaatgcggagaaaaatcacttccagctaca
gctgttgaaacggggaataaagaccaagaaataactaaatccacagttctaaagcaaaaa
ccggaacatgacgtaaatcaattcgtaaaagatatattaggaccagttaatgccttaaaa
ggagacgaacttccggtttctatgtttgatcctaccggcactgttcctcttggtactact
gcatatgaaaaaagaggcattgccatgtccattcctattgttgatatgaataaatgcact
cagtgcaattattgttcaatagtctgtccacatgcagccattcgtccattcttattagat
gaggcagaatttaagaatgcacccgaaacaatgcatataccaaaagccaagggcggtcag
gaattctcatcatattactatcgaattcaggtaactccacttgattgtactggttgtgag
ttatgcgtacatgcatgcccggatgatgcacttcatatggaaggcctgcaaaagatggaa
gcagtggagaaaactcactgggattatttaattggtcttccaaataaggctgaaaagttt
gatagaacaacagtaaagggttcacagttccagcaacctcttcttgagttttctgcagca
tgcgaaggatgcggagaaacaccttatgtaaagttattgacacaactttttggcgaaaga
atggttatagcaaatgcaacaggttgctcttcaatttggggagcatcttatccttcagta
ccatatacaaagaaccagaaaggatatggaccagcttggggtaattctctttttgaagat
aatgcggaatacggattaggaatggttgtaggatatagacaaagaagggatagatttaga
gagttagtttccaatgagattttgaaggatattactgaagaggaagagtttttaaaagat
gacaacgcctcagttcaaggtaggaacgagattattactaaatatgatcatttgaaggat
tatttaaggtcttggcttaagaacattaggaatggtgaagcatgccagagcttatttgaa
gaaatatcaaagttgcttgaggataatttgattaatagtaataattttgctcaggtattg
aaaaaagaccgaattgaactcttagaaaagctttatgattctagagatttgataccaaag
attagccattggattgttggtggagatggctgggcttacgatattggatatgccggtctt
gaccatgttttatcatttggagaggatgtaaatatcataattttggatactgaggtatat
tctaatacaggaggtcaagcttctaagagtactccttttggtgctatagcaaagtttgct
cagagtggtaatttgagacaaaagaaggatatcggatctattgcaatggaatatggatca
gtatatgttgcatccgttgctttaggagcaaactactcacaaactatcaaatctttgcta
gaggctgagaaatacccaggaacatctttgattgtagcttattcaacttgtattgaacat
ggttacactaaatataatctccaacaagaaagtgttaagcttgcagtagaaagtggatac
tggcctttgtatcgatataatccagagctggtacgaaccgaagttgtggataacctaaca
acaatagtatcttctgggtttaccttagattccaaaaaagttaaggttgatatagagaac
ttcctaaagagggagaaccgtttcttgcaattaataaggagtaacccagaattggcttca
atggcaaaagataagttaaaggctcattcagacaaaaggttccagaagatgaaggacatg
tctgagaatgtcacagtaacagctttgaaagatcaaataaagaaacttaaggatcaattg
atttccattcaaaatgcaagcaaaaccggcgaattagctgcaagtggtttaattaatgca
gatttattcattgaacaagaaatgcatgtattatacggtaccgaaacaggaaattcagaa
gaggttgcacagtatatacagagccagttggtatcaagaggatattcatccagctcattg
aatttagatgatttggatattgatgagtttttgaatccagataagttttctacagtgata
attgttacaagtacttcaggacagggagagtttccaggatcatcaggaattttatacgag
gctttgcttaagaaacacttggagaatcaggatgacaagttctgtagttttatgagattt
ggaatatttggtttaggtgattccaactacgttttcttcaatgaagcagcaaaaaaatgg
gacaaacttttgttagattgtggagcagttagaattggagcagtgggaatgggagatgat
caatcagaagaaaaatacgaaactgagctaattgaatggctaccagattatttacaattg
attaatgctccagaaccaaagcatgatgagaagagtgagattccaaaagcaactactttt
aaagtgacaatactggactcttgtagaaatgatatattaaatgaatcaactggtacttta
tgtgagaaattggatgaaaataataatattgggaattcacattataagccaataattcct
ccaaattcagttttacttcccgtaatagaaaataagagaataacaaatcaagattatgat
aaggatgtaagacatatagtatttaaattaattggtgatggaggtgatactccatctctt
tcttattgtttgggagatagtttagcattgtatggtcaaaatccagtaaatgaagcaatt
aaagctatagaaatgtttggttataatccgtatagtttgcttaggttgagtataaatgaa
gaaaatgaggcaaataatacaaataaagtaaatcagagatacagttcattatttggatat
gatataactgtgttgcaattatttgtggaatgcttggatctttggggaaagcctaatcgc
aagtttttccaggaattttatcgttattgtagtaacccagaagagaagattcaagcaaag
aagtgggcacagaatgaagggaagaaactaattgaagagttttcatcaaaaactgggaca
tatttggatgtatttaaaatgttcgaatcagcaagaccaactcttgctcagcttttagat
atcgtacctttcataaagtcgagatcatattcaatagcttcttgtaataaatttgtaaat
ggagaaaaaattgaactttgtgtaggaatagtggactggaagcttgaatcaggtgagatt
aggtatggccaatgcacaggtttcttaaatagattaccgatactagattcagaatcaaaa
atagacagtattcctagacttccttcaaatattaaagcaagcgctttcaacttacctttt
gattatagatcgccggttattatggcttgtatgggcactggaattgcaccttttagagcc
tttgttcagaataaaaagtacattagagatgtattaaaagaagaaattggaccagtaata
ttatattttggttgtagatattatgataatgactatttataccgtgaagagcttgagaat
tatgtaaaggaaggggttattacttctttgaatattgcattttctagagatccaaagggg
tataagacatcaaattgcgagaatattagatatgcacaaaagatgtatgtacaacatctg
atgcttgagaatagtcaagaaatttacgagaatatgatagaaaaatgtggttacttttac
ctttgcggtactaaacaggttcctattgatattaggaaggcaataatccagataattatt
aaacacagctccacaacagagcaggtaacctctgaagaagatgctaatagtattttgaat
agtattcagataatgggtagatataatgtcgaagcctggtcatag

DBGET integrated database retrieval system