KEGG   Cryptosporidium parvum: cgd5_4440Help
Entry
cgd5_4440         CDS       T00168                                 

Definition
(RefSeq) thymidine kinase of likely bacterial origin
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cpv  Cryptosporidium parvum
Pathway
cpv00240  Pyrimidine metabolism
cpv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    cgd5_4440
Enzymes [BR:cpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     cgd5_4440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-GeneID: 3372560
NCBI-ProteinID: XP_625605
ApiDB_CryptoDB: cgd5_4440
UniProt: Q5CQ21
LinkDB All DBs
Position
5
AA seq 202 aa AA seqDB search
DWKYFNKMAKLYFYYSAMNAGKSTVLLQSSFNYQERGMKTILFTISKDCRFEEGSICSRI
GLSEKAHTFTPDLKLLDIINQENNKEKIDCVLVDESQFLTKFQVRELCIVVDKLNIPVLC
YGLRTDFKGNLFEGSKYLLAWADKLTEIKTICRCGKKATMTIRLNSNGEPVFSGEQILIG
DNSIYTSVCRKHHIINCEEYNF
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gattggaaatactttaataaaatggcaaaattatacttttactattcagcaatgaatgct
ggaaaatcaacggttcttcttcaatcctcattcaactaccaagaaagaggaatgaaaacc
attctctttacaattagcaaagattgccgatttgaagaaggctcaatttgctctagaatt
ggtctctcagaaaaagcacacacattcactcctgatttaaaactacttgatattattaat
caagaaaataataaggaaaaaattgattgtgttctagttgatgaaagccaattcctaacg
aaattccaagttagagaattatgcattgttgttgataagctaaatattccagtactatgc
tatggtttgagaacagactttaagggaaatttatttgaaggaagtaaatacttattagca
tgggctgataaacttactgaaatcaaaactatttgtcgctgtggcaaaaaagctaccatg
actatcagattaaatagcaatggagaacctgttttttctggcgaacaaattcttattggt
gacaattctatttatacttctgtatgcagaaaacatcatataattaattgtgaagaatac
aatttctaa

DBGET integrated database retrieval system