KEGG   Coccidioides posadasii: CPC735_005140Help
Entry
CPC735_005140     CDS       T01332                                 

Definition
(RefSeq) Beta-eliminating lyase family protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00250  Alanine, aspartate and glutamate metabolism
cpw00410  beta-Alanine metabolism
cpw00430  Taurine and hypotaurine metabolism
cpw00650  Butanoate metabolism
cpw01100  Metabolic pathways
cpw01110  Biosynthesis of secondary metabolites
Module
cpw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CPC735_005140
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CPC735_005140
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CPC735_005140
   00430 Taurine and hypotaurine metabolism
    CPC735_005140
Enzymes [BR:cpw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CPC735_005140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 9693970
NCBI-ProteinID: XP_003068487
UniProt: C5P9D0
LinkDB All DBs
Position
Unknown
AA seq 554 aa AA seqDB search
MERADEVRNLLDPVQERILQFIQSADRGSKAIIAHDPSDETDPFFSGLLNLKRPSELQQE
LQVDFPDSGQGADGLLQILDRILQYSVNTWHQGFLDKLYASTNAPGLAAELIIAALNTNV
HVYQVAPALTVIEKSTAARLASLFGLNGLYAGGIAVQGGTASNTTAIVIARNTLFPETKT
EGVSGNQFVLFSSAHGHYSIEKAAQMLGFGSKAVWVVPVDEKGQMIPKALDDLIITAKSQ
GKKPFFVNATAGTTVVGSFDPLPEISEICRKHNLWFHVDGSWGGSFIFSSKQKSKLTGSH
LADSITFNPHKMLGVPVTCSFLLAADIRKFHRANTLPAGYLFHNEEYTKGFWDLGDLTLQ
CGRRADALKLFLSWMYYGSEGYEQKIDSACSVAEHLSTVVGNNPHLILLTENPPPCLQVC
FYYAPLGRMAYPPGREINGKALSEEERAELNSQITEEIVQKLVPQGFMVDYAPPSDGDTF
AKDGKFFRCVVNVLTKEETVDSLVNTIVKLGSTIVKRRLGSELNIPTPTAYPAPTSGFRP
KNPAEKGHGPVVFE
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggaacgggcggacgaagtcagaaatcttcttgaccccgtgcaggaacgcattctgcag
ttcatacagtctgcagatagaggttctaaagcaatcatagcgcatgacccttcggacgaa
actgaccctttcttctccgggttattaaacttgaaaaggcccagtgagctccagcaagaa
ctccaggtagatttcccggatagcgggcagggtgcggatggcctccttcagatcttggac
aggatacttcaatattctgtgaacacttggcatcagggatttttggacaaactctatgcc
tctacgaatgcgcccggacttgccgcggagttgatcattgcagccttgaataccaatgtt
catgtgtaccaggtcgctccggccttgaccgttatcgagaagagtactgctgcccgtttg
gcctccctttttggcctaaatggcctgtacgctggagggatagcagtacaaggtggtaca
gcatccaatacaacggcaattgttatcgcgaggaatactttatttccggagaccaaaact
gaaggcgttagcggcaatcagtttgtcttgttctcaagtgcgcatggacattacagtatt
gagaaggctgcacaaatgcttggattcggtagcaaagcggtttgggtcgttcccgtggac
gagaaagggcagatgataccgaaggcgctcgatgaccttattataaccgcgaaaagccaa
ggaaagaagccattcttcgtgaatgccactgcgggtaccacggttgtaggcagtttcgac
cctctgccggaaatctctgagatctgccgaaagcacaacctttggttccatgtcgacggt
tcatggggaggctcctttatcttctcctcaaagcagaaaagcaaacttacaggatcccat
cttgctgacagtattactttcaatccacataagatgctgggtgtgccggtcacttgttcg
ttcctcttggccgctgatattcgcaaattccaccgtgcaaacacgttaccagcgggatat
ctattccataacgaggaatacacgaagggattctgggacttgggtgacttgactctacaa
tgcggccgccgtgcagacgccctcaagctcttcctcagctggatgtactacggatctgag
ggctacgagcaaaagatcgactctgcttgtagtgttgctgagcatctttccaccgtcgtt
ggaaacaatcctcatctcattctccttactgagaatcccccaccctgtctccaagtttgc
ttttactatgctcctcttggacgcatggcataccccccaggaagagagatcaacggcaag
gcactcagcgaagaagagagagccgaactcaacagccaaataaccgaagagattgttcaa
aaacttgtgccgcaaggcttcatggtggactacgcacccccaagtgatggcgacactttt
gctaaggatggaaaatttttccgctgtgtggtcaatgttcttacgaaggaggaaacggtg
gattccctcgtgaatactattgtgaaacttggatcaaccattgtaaaacggcgactgggc
tcagagttgaacataccgactccaacagcatacccggcgcctacttccggattccgtcca
aagaaccctgcagaaaaaggccatggaccggttgtctttgaataa

DBGET integrated database retrieval system