KEGG   Coccidioides posadasii: CPC735_010710Help
Entry
CPC735_010710     CDS       T01332                                 

Definition
(RefSeq) Glycosyl hydrolases family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00052  Galactose metabolism
cpw00500  Starch and sucrose metabolism
cpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CPC735_010710
   00500 Starch and sucrose metabolism
    CPC735_010710
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CPC735_010710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 9694520
NCBI-ProteinID: XP_003069037
UniProt: C5P8C1
LinkDB All DBs
Position
Unknown
AA seq 603 aa AA seqDB search
MAVIPGLKISDLLFGIGASAMTHQSSQDLPSCQGTDSLVINLHLAGQPCNVYGEDIEKVV
LKVEYQGASRIHVMIYDEEEDVYQVPESVLSRPGPDIGSNSTEPILKFEYKSTPFAFSIR
RDNDEFHQCGYGYRDVFDVAEVVYNYSQANIQLETMWTDIDYMDRRSVFTLDPHRFPVDK
MRELIDYLHDRNQHYIVMVDPAVDYSDNGAFERGMEQDVFLKLNNGSIYKGVVWPGETAY
PDWFHPNTQEYWNNEFELFFNPDTGIDVDALGIDMNEAANFCDWPCEDTDAWVRSNDLPP
DPPAMRPNPRPLPGFPPDFQPYISKRVNRIKQRDPELLKPQYEIHNAAGALSNQTIATDL
THANGLSQFDAHNLYGTTHLQEQEHMLATGAADEQLCARWAMLGAFYPFFCNHNEIEMPR
QEFYVWGSVADAARKAIETRYNLIDYIYTAFYYQTQTGKPVLNPLFYLYPEDENTFAIDL
QFFYGDAILVSPVTTENATSVEAYLPKDIFYDYYTGAKILGKGQNVRINNVPLTHIPLHI
RGGTVVPMRFRSANNTTGLREQTLNILIAPGLHGDASGSLYLDDGESLEQECATEIDFDY
NGK
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggctgttattcccggattgaagatttccgatcttctctttggtatcggtgccagtgcc
atgacgcaccaaagctcccaagatctccccagctgccagggtaccgactccctcgttatc
aatctgcacctggctggccagccatgcaacgtttatggagaagatatagaaaaagtcgtt
ctaaaggtggagtaccagggtgcatctcgcattcatgttatgatttatgatgaggaagaa
gatgtctaccaagttcccgaatcggtgctatctcgtccaggtccggatatcgggtccaac
agtaccgaacccattctaaagtttgagtataaatccactccgttcgcgttttcaatcagg
agagataacgacgagttccatcagtgtggctatgggtatcgggacgtcttcgatgttgct
gaggtagtttacaattacagccaagcaaacatccaattagagacaatgtggacagatatc
gactacatggatcgccggagtgttttcacccttgaccctcacaggttcccagttgacaaa
atgcgcgagctaatagattatctccatgatcgtaatcaacattacattgtcatggtagat
cctgctgttgactattctgacaatggcgcttttgaaaggggaatggagcaggatgttttc
ctgaagttgaataatggatcgatatacaaaggcgttgtgtggccaggtgaaacagcgtat
cccgattggttccaccctaacactcaggaatattggaacaatgaatttgaattgtttttt
aaccctgataccggcatagatgttgatgcactggggattgatatgaatgaagctgccaac
ttctgcgattggccttgtgaagacacggatgcttgggtgagaagcaatgacttgcctcct
gatcctcctgcgatgcggccgaatcctcggccattgcccggatttccgccagactttcag
ccatacatttcgaaaagggtcaatagaattaaacagcgcgatcccgagctccttaagccc
caatacgagatacacaacgcagctggtgccctgagcaaccaaactatagctactgatctc
actcatgcaaacggactgagtcagttcgatgcgcataacctctatggtacaacacatttg
caggagcaggagcacatgttggccactggggcagcagatgagcaactctgcgctaggtgg
gcaatgctaggcgcgttttatccgttcttctgcaatcacaacgaaatcgagatgcccaga
caggaattttatgtctggggttctgtggctgacgctgcgcggaaagctattgagacaagg
tacaatttaatagactatatctatactgccttttattaccagacccagactggaaagcca
gttctcaatcctctcttctacctgtatcctgaggacgaaaataccttcgcgattgatttg
cagttcttctacggcgacgctatccttgtgagcccggtaacaacagaaaacgccaccagc
gtggaggcctatcttccgaaagatatattttacgattactacactggagccaaaattctc
ggcaaaggacagaatgttcgtattaacaacgttcccctgacccatatccctcttcatata
cgcggtggtactgtggttcccatgcgatttaggagtgcaaataatacaacgggactgaga
gagcaaaccttgaacattctcatcgcccccggtctgcatggggatgcgtccggaagtcta
tatcttgacgatggagaatcgttagagcaggaatgtgccacggagatcgattttgactat
aacgggaaatag

DBGET integrated database retrieval system