KEGG   Coccidioides posadasii: CPC735_023850Help
Entry
CPC735_023850     CDS       T01332                                 

Definition
(RefSeq) aldehyde dehydrogenase, putative
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00010  Glycolysis / Gluconeogenesis
cpw00053  Ascorbate and aldarate metabolism
cpw00071  Fatty acid degradation
cpw00280  Valine, leucine and isoleucine degradation
cpw00310  Lysine degradation
cpw00330  Arginine and proline metabolism
cpw00340  Histidine metabolism
cpw00380  Tryptophan metabolism
cpw00410  beta-Alanine metabolism
cpw00561  Glycerolipid metabolism
cpw00620  Pyruvate metabolism
cpw01100  Metabolic pathways
cpw01110  Biosynthesis of secondary metabolites
cpw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPC735_023850
   00053 Ascorbate and aldarate metabolism
    CPC735_023850
   00620 Pyruvate metabolism
    CPC735_023850
  Lipid metabolism
   00071 Fatty acid degradation
    CPC735_023850
   00561 Glycerolipid metabolism
    CPC735_023850
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CPC735_023850
   00310 Lysine degradation
    CPC735_023850
   00330 Arginine and proline metabolism
    CPC735_023850
   00340 Histidine metabolism
    CPC735_023850
   00380 Tryptophan metabolism
    CPC735_023850
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CPC735_023850
Enzymes [BR:cpw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CPC735_023850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 9694689
NCBI-ProteinID: XP_003069194
UniProt: C5P6J9
LinkDB All DBs
Position
Unknown
AA seq 505 aa AA seqDB search
MRTKSSVGIMAAQTVTLQGAEGRSIEIPTGLFINNEFVPSLTGTTLDTTNPANGDLLATI
AAASEEDINAAVQSAKDAFYTTWKATPPTTRQSLMLKLADLIERDVDEFANLEALDGGIL
LSGSKGMHVPHSVETLRYFAGWADKIDGKSIAIPSGIAYTHREPLGVCAAIVPWNAPLIV
TMWKLAPCIAAGNTLVLKTSELTPLYGIKLAALIKEAGFPAGVVNIVTGLGAVAGRALSE
HMDVRKIAFTGSTLTGRAIMKAAASSNLKKVTLELGGKGPTIIFDDADLQNAVFWATLGI
TANNGQICVAGSRIYVQEGIYEKFIAAFSAASTKAVAGDPLLSNTTKGPIVSADQHSKIM
GYIKKGQDEGARLLHGGGQPAPGYIENTAFVDVNEDMTIMREEIFGPVAAISKFKTESEA
IQKANNTEYGLSSAIFTNNVSRADRVSRALESGQVTVNSWGMVHANVPFGGIKMSGFGKD
MGEESLDGWTGTKTIKYHTLPEVPN
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaaagagttctgtcggaataatggccgcccagactgttaccctacaaggagct
gaagggcgctcgatagagatcccaactggtctgtttatcaacaatgagtttgttccatct
ttgactggaaccactcttgataccacaaacccagcgaatggggatctcctggcaactatc
gcagcagccagcgaagaagacatcaatgctgcagttcaatctgcgaaagatgctttctac
acaacctggaaagcaactcctcccaccacccgtcaatcgttgatgctcaagctggccgac
ctcatcgaacgagatgtcgatgagttcgcgaatctcgaagctcttgatggcggcattctc
ctcagcggctcgaaggggatgcatgttccccattccgtcgagacattgagatatttcgcc
gggtgggcagataagatcgatggaaaatctattgctatccccagtggcattgcctacact
cacagggagcctcttggtgtttgtgcagccatcgtgccttggaatgcgccgctgatagtc
acgatgtggaagctagctccttgtatcgccgctggaaatacgctggttctcaagacctcg
gagcttactcctctctatggtatcaagctggctgcattgattaaagaagcaggttttcct
gcaggtgttgtgaacatcgtaaccggacttggagctgtggcagggagagcgctctctgaa
catatggacgtgagaaagattgccttcactggcagcacccttacgggacgcgccatcatg
aaagccgccgcgtcttcgaatctgaaaaaggtcaccttggaacttggtggcaagggccca
accattattttcgacgatgctgacctgcaaaatgctgtgttttgggccacgctcggtatt
acagctaacaatggccagatctgtgtcgcaggttcaagaatatatgttcaggagggtatc
tatgaaaagttcattgctgcattctccgccgcttccacaaaagccgttgccggcgaccct
ctactgagcaatacaaccaaaggccccatcgttagtgccgatcaacactcgaagatcatg
gggtatatcaaaaagggccaagatgaaggagctcgtctgttgcacggcggaggccagccc
gcacctggttacatcgagaacacggccttcgtcgacgtcaacgaggacatgacgatcatg
agggaggagatctttggccctgtggcggccatttccaaattcaaaacagaaagcgaggct
atccaaaaggcaaataataccgaatacggcttgagcagtgccatctttacgaacaatgtt
tctagagctgatcgtgtaagccgagcgctggaaagcggacaggttaccgttaattcatgg
ggtatggtccacgcgaatgtgccgtttggaggcattaagatgagcgggtttggaaaagat
atgggcgaggaatcgttggatggctggactggcacaaaaacaatcaagtaccacactctc
ccggaggttcctaattag

DBGET integrated database retrieval system