KEGG   Coccidioides posadasii: CPC735_031280Help
Entry
CPC735_031280     CDS       T01332                                 

Definition
(RefSeq) Cu, Zn superoxide dismutase, putative
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cpw  Coccidioides posadasii
Pathway
cpw04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CPC735_031280
Enzymes [BR:cpw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CPC735_031280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu DUF1522
Motif
Other DBs
NCBI-GeneID: 9695432
NCBI-ProteinID: XP_003069937
UniProt: C5P502
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MVRAVAVLRGDSLVKGTVTFEQADENSPTTISWNISGHDANAQRGFHIHQFGDNTNGCTS
AGPHYNPFSKNHGAPSDVDRHVGDLGNITTDSQGNSTGSVEDKQIKLIGEHSVLGRTVVV
HAGTDDLGKGGNEESKKTGNAGPRPACGVIGIAA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcagagcagttgctgtcctccgcggtgactccctcgtgaagggcacagtcaccttc
gaacaggctgacgagaacagcccgaccaccatctcctggaacatctctggccacgatgcc
aacgctcagcgtggcttccacattcatcaattcggtgacaacaccaacggctgcacttct
gctggccctcactacaacccattctccaagaatcacggagctccatccgacgtagatcgc
catgttggtgacctgggcaacatcaccactgattcccagggcaactccaccggcagcgtt
gaggacaaacagatcaagcttattggggagcacagtgttctcggtcgcactgttgtcgtt
catgctggcactgatgacctcggcaagggaggcaacgaggaatccaagaagactggaaat
gctgggccccgtcctgcctgcggtgttattggcattgctgcataa

DBGET integrated database retrieval system