KEGG   Coccidioides posadasii: CPC735_039850Help
Entry
CPC735_039850     CDS       T01332                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit, putative
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00020  Citrate cycle (TCA cycle)
cpw00190  Oxidative phosphorylation
cpw01100  Metabolic pathways
cpw01110  Biosynthesis of secondary metabolites
cpw01130  Biosynthesis of antibiotics
cpw01200  Carbon metabolism
Module
cpw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cpw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cpw_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPC735_039850
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CPC735_039850
Enzymes [BR:cpw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CPC735_039850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 9696360
NCBI-ProteinID: XP_003070866
UniProt: C5P333
LinkDB All DBs
Position
Unknown
AA seq 647 aa AA seqDB search
MSFNGLRSLAPATRFSRSLRDQRRLFSSSRPAARIITSQPLRAKEASPFLTKKYPVIDHE
YDAVVVGAGGAGLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPQSVIELEGYGCPFSRTEDGKIYQRAFGGQSKEFG
KGGQAYRCCAAADRTGHALLHTLYGQSLRYNASYFIEYFALDLLMENGECKGILAYNQED
GTLHRFKAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGARGEGGYLLNSNGERFMERYASTAKDLASRDVVSRSMTLEIREGRGVGPEK
DHIYLQLSHLPPEILHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTRYTGEV
LTIDEKGNDKVVPGLYACGEAACVSVHGANRLGANSLLDLIVFGRAVSHTIRDNATPNTP
HKEISADAGAESIEVLDKIRTADGPKSTFDIRNAMQKTMQTDVSVFRTQESLDEGVRKIN
EVDQMFAQVGTKDRSMIWNSDLVETLELRNLLTCATQTAVAAANRKESRGAHAREDYPDR
DDANWMKHTLTFQKEPHGKVDLTYRAVTQTTLDESECKPVPPFKRVY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaacggcctgcggagccttgctcccgctacaagattctccagatctttgaga
gatcaaaggcgacttttttcatctagcagacctgcagctcgaatcattaccagccaaccc
cttcgtgcgaaagaagcctcgccatttctcacaaaaaaatacccagtgatcgatcatgag
tacgatgccgttgtcgtcggtgccggaggtgccgggttgcgagcagctttcggtttggcc
gaagctggattcaatactgcttgtgtcacaaaactctttcccacaagaagtcacacagtc
gctgcccagggtggtatcaacgccgccctcggaaatatgcacgaggatgactggagatgg
catatgtacgataccgtgaaaggttccgattggctcggtgaccaggatgctattcactac
atgaccagagaagctcctcagagtgttatcgaacttgagggctacggctgccctttctct
cgaaccgaggatggcaagatctaccagcgagctttcggtggccagtcgaaggaatttggc
aagggaggccaagcgtaccgatgctgtgctgccgccgacagaactggccacgctcttctc
cacaccctctacggccaatctctccggtacaacgctagctatttcattgaatacttcgcc
cttgacctcttgatggagaacggcgagtgcaaaggtatcctcgcatataaccaggaggat
ggaacacttcaccgcttcaaggcccatcataccgtcttagccactggcggttatggacgt
gcctacttcagctgcacttccgcccacacttgcactggtgatggtatggccatggttgct
cgtgctggattgcctaaccaagatctcgagttcgtgcaattccatccaactggtatctat
ggtgccggttgtctcatcaccgaaggagctcgtggtgagggtggctatctcctcaactct
aatggtgaacgtttcatggaacgttacgcatccactgccaaggaccttgccagtcgagat
gtcgtttctcgttctatgacccttgaaatccgtgagggacgtggtgttggccctgagaaa
gatcacatctacctccaacttagccatcttcctcccgaaatcttgcacgagcgcctccct
ggtatttcagaaactgcttccatcttcgctggcgtcgatgtcaccaagcaaccaatccca
gtcctgccaaccgttcactacaacatgggtggtattcctactcgctacactggtgaagtg
ctcaccattgatgagaagggcaatgacaaggtcgttcctggtctctatgcttgtggtgaa
gccgcctgtgtctctgtccatggtgctaaccgtcttggtgccaactctctcctcgacctt
atcgttttcggccgtgctgtttcccacacgattcgcgacaatgctactccaaacactcct
cacaaggaaatcagtgccgatgccggtgctgagtctatcgaagtgcttgataagatcaga
actgctgatggaccaaagtccactttcgacatcagaaacgctatgcagaagactatgcag
acagatgttagcgttttccgtactcaagagagtttggacgagggtgttcgcaagattaac
gaagttgaccaaatgttcgcgcaagttggaactaaggatcgcagcatgatctggaactcc
gacctcgtggagacccttgagttgagaaacttattgacttgcgctactcaaacagccgtt
gctgctgctaaccgcaaagaatcgcgtggcgcccacgcccgcgaggattaccccgaccgt
gacgacgccaactggatgaagcataccctcacattccagaaggaaccccatggaaaggtc
gatctgacttaccgcgctgtgacacagactacgctggacgagagcgagtgcaagcctgtc
ccaccattcaagcgcgtatactag

DBGET integrated database retrieval system