KEGG   Coccidioides posadasii: CPC735_042850Help
Entry
CPC735_042850     CDS       T01332                                 

Definition
(RefSeq) Isocitrate dehydrogenase, mitochondrial precursor, putative
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00020  Citrate cycle (TCA cycle)
cpw00480  Glutathione metabolism
cpw01100  Metabolic pathways
cpw01110  Biosynthesis of secondary metabolites
cpw01130  Biosynthesis of antibiotics
cpw01200  Carbon metabolism
cpw01210  2-Oxocarboxylic acid metabolism
cpw01230  Biosynthesis of amino acids
cpw04146  Peroxisome
Module
cpw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cpw_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPC735_042850
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CPC735_042850
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CPC735_042850
Enzymes [BR:cpw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CPC735_042850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 9693469
NCBI-ProteinID: XP_003067986
UniProt: C5PB57
LinkDB All DBs
Position
Unknown
AA seq 509 aa AA seqDB search
MPALRASSVPSRLSLTRLARNNSQPAPRLLSTFSIRPAPPLPLNSSTARSCLPSTSSIHN
TSAATTRFQSSFAPQRAVSWTAASSPSLSHTQTRNMSTGRKKIKVKNPVVELDGDEMTRI
IWQDIKDKFIYPYLDVDLKYYDLGLEYRDQTDDKVTVDAAEAIKKYGVGVKCATITPDEA
RVEEFKLKKMWLSPNGTIRNILGGTVFREPIVIPRIPRLVPGWKKPIIIGRHAFGDQYRA
TDRLVPGPGKLELVYTPTNGEPERITVYDFQGAGIAQVQYNTDDSIRGFAHASFKLALLK
GLPMYMSTKNTILKKYDGRFKDIFEEVYEAEYKKAFEAKGIWYEHRLIDDMVAQMIKGDG
GCVIAMKNYDGDVQSDIVAQGFGSLGLMTSTLTTPDGSAFESEAAHGTVTRHYREHQKGR
ETSTNPIASIFAWTRGLIRRGQLDETPDVVTFAEQLERACIEVVDEEGIMTKDLALSCGK
KERDAWVTTREYMDAVERRLRSNLANAKL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctcttcgggcgagttccgtcccatcccgactctccctgacccgcctcgctcgc
aataattcacagcccgctccccgactgctctcaacgttttctatccgtcctgcccctcct
ttgcctttgaattcttccactgcgcgctcttgtcttccttctacttcctctatccacaac
acctccgccgcaaccactcgtttccaatcctcctttgccccccagagagcagttagctgg
actgctgcatcatccccctcattgtcccatacacagacgcgcaacatgtcgaccggacgg
aagaagatcaaggtcaagaaccccgtggtggagttggatggtgatgagatgaccagaatt
atctggcaggatatcaaggacaaattcatctatccataccttgacgttgacctgaagtac
tatgacttgggcttggagtatcgcgaccaaaccgatgacaaggtcacggtagatgccgct
gaggctatcaagaaatatggcgtcggtgtcaagtgtgccaccatcacccctgatgaggcg
cgtgttgaggaattcaagttgaagaagatgtggctttctcccaacggaaccatcagaaat
atcctaggtggaaccgttttccgtgagcccatcgtcattccccgcattccaagacttgtt
cctggctggaagaagccaatcatcatcggaagacatgccttcggtgaccaatatcgtgcc
actgatcgtcttgtccccggacccggcaagttggagcttgtctacactcccacaaacggc
gaaccagagcgcattaccgtatatgacttccaaggagccggtatcgcccaggtccagtac
aacaccgacgactccatccgaggattcgctcacgctagcttcaagctggcccttctgaag
ggtctgcccatgtatatgagcaccaagaacaccatcttgaagaaatatgatggtcgattc
aaggatatctttgaggaagtgtacgaggccgaatacaagaaagccttcgaggccaagggt
atctggtatgagcaccgcctgattgacgacatggttgcccagatgatcaagggcgacgga
ggttgcgttatcgccatgaagaactatgatggtgatgttcaatccgacatcgttgctcaa
ggcttcggctcccttggcttaatgacatccactctcaccaccccagacggctctgccttc
gaatcggaagctgcccatggcacagtcactcgccactaccgtgagcaccagaagggtcgt
gagacttccaccaaccccatcgcgtccatcttcgcatggactcgtggcttgatccgccgc
ggtcaactcgacgagactcctgacgttgtcaccttcgctgaacaactcgagcgtgcctgt
atcgaggtcgtcgacgaggagggcatcatgaccaaggatctggctctgtcctgcggcaag
aaggagagagatgcttgggttaccacccgagagtatatggatgccgttgagagacgcctc
cgcagcaatctggccaacgccaagctctaa

DBGET integrated database retrieval system