KEGG   Coccidioides posadasii: CPC735_048610Help
Entry
CPC735_048610     CDS       T01332                                 

Definition
(RefSeq) Glutathione S-transferase, N-terminal domain containing protein
Organism
cpw  Coccidioides posadasii
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C_5 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 9691106
NCBI-ProteinID: XP_003065636
UniProt: C5PG38
LinkDB All DBs
Position
Unknown
AA seq 782 aa AA seqDB search
MLSSAMMDDAGSETPTNPPQLPPPQPSPELGALPRTPLNEHGLSLDRDLEAEIKNGGTHN
QGQLPGDSEEPRVQEGPGQEGLKDGQAWDQIMVDAVPTTDAIATAAIVTEQAQNEPAHAA
IVVDPEISTPEAQNHGSSIGQSSIQRQPRQSQTSVAPDSNSVPAITAPQYTLLESRQAAA
PQHLGQPSPIPPPSPNYGLPAHPEFIQPRSNHGHPMSLPPCPPSGAPQIQHNLPSQTPSQ
QQQPTLQNLICHFPSPIQSSPAAPGLSNDGTSHFKNMKLIPEPPDLQRWRERLFNVEGTI
VLSEEEFQTYFPHVDNVYSHRSTQRYKRKPFISHYWDCRLKGRPPGTPKSADPNKKKRKR
IARERNLCDVKIKITEYFPGALTMAPDLDMGISALAGAVDSLPATSGVNAPTASQPFGVL
APSTMLPEGHPGATGARYYTIQRVNGNGANGRSVTAGGSHRHTLEESDRIKKNSVQRFLI
KDEKEKKKAISYFSSPGLEYKTMRNKLLLRFLHYSRIAMTDQKQSQQLKTYHKKASGYAW
LTVNKHKRESDLKLYASCFCPFVQRVWIALEVKGIPYQYIEVDPYRKPDSLLEVNPRGLV
PAIRHGNWACHESTVLLEYLDDLDAGNPLLPPGKPQLRAHCRLWADHVNRHIIPCFYRLL
QEQDFQKQIEYTEELKDDISKLVNASHVTGPFFLGPDISFVDIQFAPWMLRLSRVLKPYR
GWPDPEKGSRWAAWVDAIEANDQIMATTSSDELYLDSYQRYAENRPDTSMLANAINSGRP
LP
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgctctcctccgcgatgatggacgacgcagggtcagaaacaccgacaaatccaccccaa
ttgccaccaccacaaccatcgccagaacttggagccttacctagaactcccctgaacgag
cacggattgagcttggatcgcgacctagaggccgagattaaaaatggtggtacacataat
caagggcagttgcccggggactctgaagagcccagggtgcaagagggccctggccaggaa
ggcctgaaggacgggcaagcatgggatcaaataatggtcgatgctgtacctaccactgac
gcaattgcgaccgccgccatcgtcactgaacaagctcagaacgagccggcgcacgctgcc
attgttgtcgacccagaaatctcgacccctgaggcgcagaatcatggtagcagcattggc
caatcctcaattcaaaggcaaccgcgtcaaagccagaccagcgtggctcctgacagtaat
tccgtcccagcgattaccgcaccgcagtatactttgctagagagtcgccaggcggctgct
cctcagcatcttggtcaaccatcccctattccaccgccttcaccaaattatgggcttcca
gcgcatccagaattcatccagccacgtagtaaccacggccacccgatgtcacttcctccg
tgccctccatcgggcgcgccgcagatccaacataacttgccgtcgcaaacaccttcacaa
cagcaacagccgactcttcaaaacctaatatgccactttcccagtcctatccaatcgagc
cctgcagcaccggggttaagcaatgacggtacaagtcattttaagaatatgaaactcatt
cctgagccgccagatctacagcgttggagagaaagactgttcaatgttgagggtactatc
gtcctgagtgaggaggaatttcagacctattttccacatgtcgacaacgtctactcccac
cgctctactcagcgctacaaacgcaaaccttttatatcccattactgggactgtcgactg
aaaggtcgcccaccgggaacccccaaatctgccgacccaaacaaaaagaagcgcaaacgt
atcgcgcgcgagaggaatctatgcgacgttaaaataaaaatcacagagtacttcccggga
gctttgaccatggccccggatctggacatggggatctcggcgctcgccggcgctgttgac
tcattacctgccacgtccggagtcaatgcgccgacggcttcccaaccgtttggcgtgtta
gcaccgagtacgatgctacccgagggccatccgggcgcgacaggagcgagatattacaca
attcaacgagtaaatgggaacggggccaatggcaggtccgtcacggccggtggatcgcat
agacatactctggaagaaagtgatcggatcaagaagaacagtgtgcagcggtttctgata
aaggacgagaaggaaaagaaaaaggccatctcttatttctcttctcctggtctggagtac
aagacaatgcgaaataaattactcctaagatttctacactactccagaatcgcaatgact
gaccaaaaacagagccaacagctcaaaacgtaccacaaaaaggcgtccggctacgcttgg
ctaacggtgaacaaacataaacgagagagcgatctcaagctttacgccagttgcttttgc
cctttcgtccagcgggtttggattgcacttgaagttaagggaataccgtaccaatacatc
gaagttgacccctatagaaagccggattcgctgttggaggtcaatccgcgggggttagtt
ccggctatacgtcacggcaactgggcttgtcacgaaagtaccgttttgttggaatatctc
gacgatctcgatgccgggaatcctctcttgcctcccggaaaaccacaacttcgggcgcat
tgccgattgtgggcagaccatgtaaaccggcatatcataccctgtttctatcgtcttctc
caagagcaagatttccagaaacagatcgagtatacggaagagttaaaggacgatattagc
aaactcgtcaacgcgtcccatgtaacgggaccgttcttccttgggccagacatctccttt
gtcgacattcaatttgcgccctggatgcttaggctgagtcgcgtattaaagccatatcgt
gggtggccagatccagagaaaggcagtcgctgggctgcgtgggtggatgccatagaagcc
aatgaccagatcatggccacaacgagttcagatgaactatacttggatagctatcagaga
tacgccgaaaatcgacccgacacatcgatgctggcgaacgccattaattccggaagacct
ctgccgtaa

DBGET integrated database retrieval system