KEGG   Coccidioides posadasii: CPC735_053560Help
Entry
CPC735_053560     CDS       T01332                                 

Definition
(RefSeq) hexokinase, putative
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00010  Glycolysis / Gluconeogenesis
cpw00051  Fructose and mannose metabolism
cpw00052  Galactose metabolism
cpw00500  Starch and sucrose metabolism
cpw00520  Amino sugar and nucleotide sugar metabolism
cpw01100  Metabolic pathways
cpw01110  Biosynthesis of secondary metabolites
cpw01130  Biosynthesis of antibiotics
cpw01200  Carbon metabolism
Module
cpw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cpw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPC735_053560
   00051 Fructose and mannose metabolism
    CPC735_053560
   00052 Galactose metabolism
    CPC735_053560
   00500 Starch and sucrose metabolism
    CPC735_053560
   00520 Amino sugar and nucleotide sugar metabolism
    CPC735_053560
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CPC735_053560
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cpw04131]
    CPC735_053560
Enzymes [BR:cpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CPC735_053560
Membrane trafficking [BR:cpw04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CPC735_053560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF2587
Motif
Other DBs
NCBI-GeneID: 9691601
NCBI-ProteinID: XP_003066131
UniProt: C5PHI3
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MTVTTPRRRPSRKGSMADMPKDLLEQVKELEELFTVDQARLKKIVDHFVKELEKGLSVQG
GNIPMNVTWVMGFPTGHEQGTFLALDMGGTNLRVCEIFLCEKKGEFDITQSKYRIPEELK
SGNADDLWEYIADCVQQFIEYHHEEENLPDLPLGFTFSYPATQEYIDHGVLQRWTKGFDI
DGVEGEDVVPMLEAALAKRGLPIKVAALINDTTGTLIASAYTDPEMRIGCIFGTGVNAAY
MENAGSIPKIAHYNLPPDMPIAINCEYGAFDNERVVLPLTQYDVVIDRDSPRPGQQAFEK
MTAGLYLGEIFRLVLLDLIDNKGNLIFEGQDVSSLRKPYCLDSSFLAYIEEDPFENLSET
RDLFERNLGIKATKPELELCRRLAELIGTRAARLSACGVAAICKKKNIKSCHVGADGSVF
NKYPHFKARGAKALREILDWADDEEDKVIICSAEDGSGVGAALIAALTLERVKQGNLAGI
RKTDTMKKLL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcaccactcctcgccgaaggccgtcccggaagggatcaatggccgatatgcca
aaggacctgctcgagcaggtgaaggagctcgaggagctcttcacagtcgaccaggctcgg
ttgaagaaaatcgtggaccactttgtaaaagagctggagaaaggtctcagtgtacagggt
gggaacatccctatgaatgtcacttgggttatgggctttcccactggccatgaacagggt
acgttcctcgcgcttgatatgggcggtaccaacctccgtgtctgcgagatcttcctttgc
gagaagaagggtgaattcgacatcactcagtccaaatatcgcattccggaggagttgaag
agcggcaatgccgatgacctctgggaatacatcgccgattgtgttcagcagttcattgaa
taccaccatgaggaggaaaatttgccggacctacccctgggcttcaccttctcctatccc
gctactcaggagtatattgaccacggtgtgttacaacgatggactaagggctttgatatt
gacggcgtggagggtgaggatgttgtgcctatgttagaagcggcccttgcaaagaggggt
ctcccgatcaaagtcgctgccttgatcaatgataccaccggaactctgatcgcctctgct
tacactgatcctgagatgaggattggctgcatcttcggaacaggagttaacgcggcatac
atggagaatgcgggatccatcccaaaaatcgctcattacaaccttccccctgatatgccc
atcgccattaactgtgaatatggtgcctttgataacgagcgtgtggtacttccgttgact
caatatgacgtcgtgattgaccgtgactccccgcggcccgggcaacaggccttcgaaaag
atgaccgccggtctgtatcttggcgaaatcttccggctggtccttctagaccttattgac
aacaaaggcaatctcattttcgaaggccaggacgtcagcagcctccggaaaccgtactgc
ctagactcttccttcctggcgtacatcgaagaagatcctttcgagaacttgtctgaaacc
agggaccttttcgagcgcaatcttggaatcaaggccaccaagcctgagcttgagctctgc
cgccgcctagcagaacttattggtactcgcgctgcgcgcctctccgcttgcggtgtcgcg
gccatttgcaaaaagaagaatatcaaatcttgccatgttggagctgacggttccgtcttc
aacaaatatccccatttcaaggcccgcggagccaaggcacttcgtgagatcctcgactgg
gctgatgatgaggaagataaagtcattatatgctctgccgaggacggttctggtgttggt
gccgcactgatcgcagcgctgacgctcgagagagttaagcagggaaatctagccggcatt
cgaaagacagacacgatgaagaagctgctgtga

DBGET integrated database retrieval system