KEGG   Coccidioides posadasii: CPC735_055100Help
Entry
CPC735_055100     CDS       T01332                                 

Definition
(RefSeq) ATP-dependent DNA ligase, putative
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cpw  Coccidioides posadasii
Pathway
cpw03030  DNA replication
cpw03410  Base excision repair
cpw03420  Nucleotide excision repair
cpw03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CPC735_055100
   03410 Base excision repair
    CPC735_055100
   03420 Nucleotide excision repair
    CPC735_055100
   03430 Mismatch repair
    CPC735_055100
Enzymes [BR:cpw01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CPC735_055100
    6.5.1.6  DNA ligase (ATP or NAD+)
     CPC735_055100
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CPC735_055100
DNA replication proteins [BR:cpw03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CPC735_055100
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CPC735_055100
DNA repair and recombination proteins [BR:cpw03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CPC735_055100
   NER (nucleotide excision repair)
    Other NER factors
     CPC735_055100
   MMR (mismatch exicision repair)
    Other MMR factors
     CPC735_055100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DUF3246
Motif
Other DBs
NCBI-GeneID: 9691755
NCBI-ProteinID: XP_003066285
UniProt: C5PHY7
LinkDB All DBs
Position
Unknown
AA seq 969 aa AA seqDB search
MRLSRFCLTRSKTTLAPLIYGQPTSIRFSCSVSSYFVIQRRGYTLITTNMAQKSERKQTT
LGKFFGGNAASLPETKNQSTLSFSSEAGSAKSETKPAKDLQDNEDDDVDMEDSSRDIPTK
TGPVTPTKNGTVCSRPASPGAPRVDSDEEIKSESARSESASPSARKLKRQKDSVVEESDG
NESEPVTKRRRGPTKPKTESSTSKPAAGRKNRKASPRGKTNDKGATSTPNKQLEINESAV
GNAESSESDQDDLLSESSSEELDIKPEKEEKKKNTASKQRQKVQATLKSSANDPYPDWKA
GDPVPYAALCTTFSLVEMTTKRLAILAHCSLFLRQVLRLTPEDLLPTVQLMINKLAADYA
GIELGIGESLIMKAIGESTGRSLAVIKADQHEIGDLGLVAAKSRSNQPTMFKPKPLTVRG
VHESLLAIAKMQGHGSQEKKVGGIKKLLSSADSATAGKGSKGIDITKNKGGPSEAKYIVR
FLEGKLRLGLADKTVLVALAHAMVAHETLSKGNKTPSAEQLAKGEAILKQVYSELPSYEV
IIPAMLEHGIFNLQENCKLQPGVPLKPMLAKPTKSISEVLDRFEGKDFTCEYKYDGERAQ
IHYVSQDAIKDYTATAGTLQKDGKGLCAIFSRNSEDLSKKYPDVLDKLESWVRPGTKSFV
LDCETVAWDLENKKVLPFQQLMTRKRKDVKAEDIKVRVCIFAFDILFLNGAPTVKMTFRE
RRALLHETFVPTEGEFAFAQYGNTSNVEEIQTLLDESVKSSCEGLMVKMLDTEESGYEPS
KRSRNWLKVKKDYLAGIGDSLDLVVIGAYFGKGKRTSVYGAFLLAAYNPSTENYETICNI
GTGFSDALLDELHKSLSPLAISQPKPFYSHSSVPKDQPDVWFEPRLVWEVKAADLTISPR
YRCASDEVMGMAGADGKGVSLRFPRYIKARDDKKPDQASTTRMVAEMYRKQESVTKEDKG
KGVDDDWEY
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atgcggttgtcgcgtttttgtctgacgcggagcaagacaaccttagcgcccttaatttac
ggacaacccacgtcgatccggttttcttgctcagtatcctcatactttgttatccaacgc
aggggatataccttgatcacaacaaatatggcgcagaagagcgagagaaagcagactact
ttagggaagttctttggcggaaacgcagcctcgctccccgaaacaaaaaaccagtctaca
ctctctttttcatctgaagctggaagcgcgaaatctgagacaaaaccggccaaagatctc
caagataatgaagacgatgatgttgatatggaagattcaagtcgcgatattcctactaag
actggccccgtaacgccaacgaaaaacggaaccgtttgttcaaggccagcttctcctggg
gctcccagagtagattcagatgaagaaattaaatccgagagtgcgaggagtgaaagcgcg
tcgccaagcgcaagaaagcttaagcgacagaaggattcagtggttgaagagagtgatgga
aatgagagcgaacctgtcaccaaaaggcgaagagggccaacgaaaccgaaaacagagagc
tctacatcgaagcctgccgctggaagaaaaaacagaaaggcctcgccaaggggtaaaacc
aatgataaaggcgctaccagcacacccaacaagcaactggagataaatgaatcagcagtc
ggaaatgcagagtcctcagaatctgaccaggacgatctattgtcagaaagtagctcagag
gagctggatatcaaacctgaaaaagaggaaaagaagaaaaacacagcatcaaaacaaaga
cagaaggttcaggcaaccttgaaaagcagcgcaaatgatccatatccagattggaaagct
ggtgaccctgttccctatgccgccttgtgcactacattttccctcgttgaaatgaccacc
aaaagattggctattctagcccattgctctctattccttcgtcaagtcttacgattgact
cctgaggatttacttccaacagtccagcttatgatcaataagctagctgcggattacgcc
ggtatcgagctcggaatcggcgagtccttgatcatgaaagccatcggcgaatccaccggg
cgtagtcttgccgtcatcaaagctgaccagcatgagatcggggatctgggccttgtcgcg
gctaagagtcgatcaaatcagcccactatgttcaaaccaaaaccattaaccgtgcgagga
gtccatgagagtctcttggcaattgctaagatgcaaggacacggatcccaggagaagaaa
gtcggaggtattaaaaagctcctttcttcagctgattccgctacagctggaaagggctca
aaagggattgacatcacaaaaaataaaggcggtccgagtgaggccaagtatattgtccga
tttttagagggcaagctgcggctaggtcttgctgataaaaccgtcctcgtggctctagct
catgccatggtagcgcatgaaactttgtcaaagggcaacaagacacccagcgctgagcag
ctagcaaaaggagaagctattcttaagcaagtatatagcgaattaccatcttacgaagtg
attatccccgccatgctagagcatggaatatttaaccttcaggagaattgcaaactgcag
ccgggggttccattaaagcccatgttagcaaaacccacaaaatccatttctgaagtcctc
gaccgctttgaaggaaaagactttacctgcgaatacaaatacgacggtgaaagagctcag
attcactacgtgtcacaagatgcaatcaaggattatactgccacagctggaaccttacaa
aaggatggcaaaggcctttgtgctatattttcccgtaactccgaggatctatctaagaag
tatccagatgttcttgataagctggaatcgtgggtccggccaggaaccaagagctttgtc
ctggactgcgagactgtcgcatgggatctcgagaacaagaaggtcttgccattccagcaa
ctcatgacacgcaagagaaaggacgtgaaagccgaagacataaaagtccgcgtttgcata
ttcgcgttcgatatcctgttcttgaatggagcacctactgtgaaaatgacattccgggaa
cggcgtgctcttttacatgaaacatttgtcccaaccgaaggggagtttgctttcgcacaa
tatggaaacacgagtaacgtggaagagatccaaactctcttagacgagagtgtgaagtct
tcttgcgaaggtttgatggtaaagatgctagataccgaagaaagtggctatgaacctagt
aagcggagtcgcaattggctcaaggtcaaaaaggactatcttgctggtattggtgactcg
ctcgaccttgttgtcatcggcgcctacttcggcaagggtaaacgtacttcggtctacgga
gcctttctcctcgctgcgtacaaccctagcactgaaaattacgagacaatatgcaatatc
ggtacgggcttctctgatgccctattggacgaacttcacaaatctctcagtcccctcgcc
atatcccaaccaaaaccgttttactcgcattcttccgtccccaaggaccagccagatgtc
tggttcgaacctcgcctagtatgggaggtcaaggcggcggatttaaccatcagtccccga
tataggtgtgcgagtgacgaagtgatggggatggcgggtgcggatggaaagggggtctcg
ctacggtttccaaggtatatcaaagcaagagatgataaaaagccagaccaggcgagcacg
actaggatggtagcggagatgtatcgaaagcaagagagtgtgacaaaagaggacaagggc
aagggagtggacgatgactgggagtactag

DBGET integrated database retrieval system