KEGG   Coccidioides posadasii: CPC735_055250Help
Entry
CPC735_055250     CDS       T01332                                 

Definition
(RefSeq) Glutathione S-transferase, putative
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CPC735_055250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpw02000]
    CPC735_055250
Enzymes [BR:cpw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CPC735_055250
Transporters [BR:cpw02000]
 Other Transporters
  Pores ion channels [TC:1]
   CPC735_055250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_C_3 GST_N_2 GST_C_2 Tom37 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-GeneID: 9691770
NCBI-ProteinID: XP_003066300
UniProt: C5PI02
LinkDB All DBs
Position
Unknown
AA seq 217 aa AA seqDB search
MSLKPFKIYGTLLGPNPFKVATVLSELSLPYEVVQVAREDIKGEAFTALNPNGRLPALVD
PNKDDFTIWESGAIVNYLITEYDTEHKLSFPVGTKEYHLTQQWLHFQMSGQGPYYGQWFW
FKNYHSEQLPSAVERYANEVRRVTVVLDKWLENKQFLVGDKYTFADLAFFPWQMLVPSLA
GVDMEKEAPNVHRWMENMKNRPAVAKVLEEHKASKWN
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcaaaccattcaaaatttatggcactctcctgggtcccaaccctttcaaagtt
gccaccgttctctccgaactctctctcccttacgaagtcgttcaagtggcccgtgaagat
atcaaaggcgaggccttcactgctttgaaccccaatggtcgtctcccagcccttgtggac
cccaacaaggatgattttaccatttgggaatctggcgccatcgtcaactacctcatcacc
gaatacgacaccgaacacaaactgagtttccctgtcggcaccaaagagtaccacctaacc
cagcaatggctccatttccaaatgtccggccagggtccctactacggacagtggttctgg
ttcaagaattaccattctgagcaattgccgagcgcggtcgaacgctatgcgaacgaggtg
agacgagtgaccgtcgtgttggacaagtggctggaaaacaagcagtttttggttggcgac
aaatacaccttcgcagaccttgccttttttccctggcagatgttggtaccatctctggca
ggggtggatatggaaaaagaggctccgaacgtgcatcggtggatggaaaatatgaaaaat
agaccggctgtcgcgaaggtacttgaagaacacaaggcttccaagtggaattag

DBGET integrated database retrieval system