KEGG   Coccidioides posadasii: CPC735_062530Help
Entry
CPC735_062530     CDS       T01332                                 

Definition
(RefSeq) histone deacetylase, putative
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
cpw  Coccidioides posadasii
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cpw03036]
    CPC735_062530
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CPC735_062530
Chromosome and associated proteins [BR:cpw03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CPC735_062530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 9696020
NCBI-ProteinID: XP_003070525
UniProt: C5P3W2
LinkDB All DBs
Position
Unknown
AA seq 1093 aa AA seqDB search
MDGRKPPPAMAPKQHAGSSGRQSTLTTNNEREQLVSSFNQLSLAPQAALPRQSPSRTSSQ
SYRTLDKPQQAQHDPLAHRSPVPRRTPSINSLREDRRSSTPSLKKRLSTASLRSVQNSNG
VGSPRPSTSRRASHQFLSTPGSMMRPISPSVMSECPSPPPLPTASSIAAEHFEKELALHQ
STDLRSKTVVILQDACYGHRYSRPRTSKAGLESIVERPERLRAGILGVASAYVRMGKRWG
NHRCAPHPDLDLSSLPVPPFQILKTTRTLPLNSPAITHVHGAKWMGELKMMCDAAESRLA
LNGKELVRPNSSGSDSSGSVPKLHEGDLYLCPESLNAFEGALGGVCEAIDTVFESDATRR
AFVCIRPPGHHCSSNFPSGFCWLNNVHVGIAHAAMTHGLTHAAIIDFDLHHGDGSQAIAW
EQNQRAISASRNAPLHKKTRIGYFSLHDINSYPCESGDEAKVMSASVCIDNAHGQSVWNV
HLEPWKDAMEFWQLYNTKYAVLLDKARCFLRSCSQQLRDSPNSTHPKAAIFLSAGFDASE
WEGIGMQRHKVNVPTDFYAKFTSDINRLAEEEDLAVDGRIISVLEGGYSDRALTSGIFSH
LSALADTRNVVVDDMDAQSRLASEMFSRLNLSDKASNAPSCDSTEEPILFDTIWWTGPML
EELEIIAQKPPPAPIRKLREKGQPSFLAHTQASAAKAVTPVRERGVLFSHHATLDEPFSL
PEVDWALAAVELSKAIIPTDRQTSSLKHADLKGENARSKRERHSLTGSTDLESVSERGHM
QLRERKPKAPVIPELQPGNSRSSSRSTRRTTIASSSDLADGALPETPIESLDQTQVVVPQ
HSRKLSVTSSVASVGSAAPRNISLRKPREASSRPVSRAQASTRPATSMGINVQKQRAVGV
GDRSGSRKSTPLDTTSAQSQHGDVDHLSNGVKKLSLKLKVPTPEEHAAREAARIAEERNR
NMSKTAKKTPAAKPTKQIAGKSTSKTSRNATISEAPRAESDTADPRMIPLPSESTPVSST
EHSLAISAGREQHQTTDHPSFPSPPLTPLSPCARPQTTVKSAPPKAYTKEDLPVFTSTSV
IPFGPSRDSNTGS
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atggacgggcggaaacccccgcctgcaatggcgcccaaacagcacgctggatcgtcaggg
cgacagagcactctcacaacaaacaatgagcgtgagcagctggtgagctccttcaatcag
ctctcgttggctcctcaggctgctttgccccgtcagtccccctcgcgaacctcttcccaa
tcctatcgaaccctcgacaagccccagcaggcgcaacatgatcctctcgcgcaccgttct
cccgttcctcgaagaacacccagcattaactctttgagggaagaccgtcggtcctccacc
ccgtctttgaagaaacgcttgtctaccgcttcgctccgctccgttcagaactccaacggc
gttggctctccgcgccccagcacctcgagacgcgcgtcccaccaattcctatcgacgcca
ggatcgatgatgcgaccaatatccccttccgtcatgtcggaatgtccttcacctcctccc
ctgcccaccgcctcatccatcgctgcggagcatttcgagaaagagcttgcacttcaccag
tccacagacctacgatcaaagacggtcgtgatccttcaagatgcttgttatggacataga
tattcacgcccaaggacttctaaagcggggttagaatccatagtggagcgcccggaacgt
ctacgcgcagggatcttgggtgtcgcgtctgcgtacgttcggatggggaaaagatggggg
aatcatcgctgtgcacctcaccccgacctagacctaagttcgttaccggtgcccccgttt
cagattctgaaaacgacgagaactttaccgttaaactctccagcgatcacacatgtccat
ggggcaaagtggatgggagaactgaaaatgatgtgtgacgcggcggaatcgcgcttggcg
ctgaatggcaaggagcttgttcgtccaaacagttcaggcagtgatagctctggttccgtg
ccgaaacttcatgaaggtgatttatatctctgtccggagtctttaaatgcgtttgaaggt
gcattgggaggcgtgtgtgaggcgattgataccgtttttgagtcggatgccacacgtcga
gcttttgtatgcattcgtccccccgggcaccactgttcctcaaattttccttctggattt
tgctggctgaataatgtacatgtcggcatcgcgcacgctgcaatgacccacggtcttaca
catgccgcgattattgactttgacttgcatcatggcgatggctctcaggctattgcttgg
gaacagaatcaaagggccatatcagcatccaggaatgcgccactgcataaaaagaccagg
atcggatatttcagtttgcacgatatcaactcatatccgtgcgaaagtggcgatgaagct
aaagtcatgagcgccagcgtctgcattgacaatgctcatggacagtccgtttggaatgtg
caccttgaaccatggaaggacgccatggagttctggcagctctacaatacgaaatacgcg
gtccttctagataaggctcgctgtttcttgcggtcatgctcccaacagttgcgcgactcg
ccaaattctacacacccaaaagctgcgattttcctctctgcgggattcgacgctagtgaa
tgggaagggatcggcatgcagaggcataaagtcaacgttccgacggacttctacgctaaa
tttacgtcagatatcaaccgactcgccgaagaagaagatctagccgtggatggaaggatt
attagtgtccttgaaggaggatatagtgatcgagcgctaactagcggtattttcagccac
ctctcagcgcttgctgatactcgaaatgttgttgtcgacgatatggatgcgcaaagccgc
ctcgcttctgaaatgttcagtcgccttaacctgagtgataaggctagcaatgctccaagt
tgtgactcaactgaggaacccatactttttgatactatatggtggactggacctatgttg
gaagaacttgagataattgcacagaaaccgcctccggcgcctattcgtaagctccgtgaa
aagggtcagccaagctttttggcacacacccaggcatccgctgcgaaagccgtcacccca
gtcagggaacgtggtgttttgttttcacaccatgctactctggatgagccgttctccctt
ccagaagtcgactgggccctggcagcggttgaactgtcgaaggccatcatacctactgat
aggcaaacttcgagcttaaagcacgctgatttgaagggagagaacgcaaggtccaaacga
gagcgccattcgctgacaggatctactgaccttgaaagtgtttctgaacgcgggcatatg
caacttcgggaaagaaagcctaaagcaccggtcatcccagagctgcagcccggaaattca
agatcatcatctcgcagtactcgtcggaccaccattgcatcatccagtgatctggctgat
ggtgctcttcctgaaacaccaattgagtcccttgatcagactcaggtggtggtgccacag
cattcacgaaaacttagcgtcacttcgagcgtggcatcggtgggcagtgcagctcctagg
aatatctctctgcgcaaacctcgtgaagcttccagccgtccagttagccgggcacaagca
agtactaggcctgcgacatctatggggataaatgtgcaaaagcagagagctgtgggagtg
ggtgatcgatcaggatccaggaaatccactccgctcgacaccacctccgcacaatcccag
cacggagatgtcgaccacctttccaatggcgtgaaaaaattaagccttaaactgaaagtt
ccgactcccgaagagcatgctgcgagggaagctgcaagaattgccgaagaacggaataga
aatatgtcaaagacagctaagaagacccctgccgcaaagccgacgaagcagatcgcagga
aagtctacatcgaaaacttcgcgtaatgcgactatttcagaagctccgagagctgagtct
gacaccgccgacccacgtatgattcctcttccctcagaatcaaccccagtctcgtctacc
gagcactcactcgcaatctctgcaggtcgcgaacagcaccaaactaccgaccacccgtct
tttccttctccgccccttacaccattgtcaccctgcgccagaccccaaaccacagtcaag
tcggcccctccaaaagcttacacaaaggaagaccttcctgttttcacctcgacttctgtc
attccctttggcccttcccgcgatagcaataccggttcatag

DBGET integrated database retrieval system