KEGG   Coccidioides posadasii: CPC735_072260Help
Entry
CPC735_072260     CDS       T01332                                 

Definition
(RefSeq) repressible alkaline phosphatase, putative
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00730  Thiamine metabolism
cpw00790  Folate biosynthesis
cpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CPC735_072260
   00790 Folate biosynthesis
    CPC735_072260
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpw04147]
    CPC735_072260
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cpw00537]
    CPC735_072260
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CPC735_072260
Exosome [BR:cpw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CPC735_072260
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cpw00537]
 Enzymes
  CPC735_072260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 9697183
NCBI-ProteinID: XP_003071689
UniProt: C5P1I6
LinkDB All DBs
Position
Unknown
AA seq 606 aa AA seqDB search
MSRNDPLLVPSDHSPERSDAEEDALLTGQRTHRSERRRGPSFWREVGLFSWALIATAAVI
ILAVVYQHQQSTGRREGSLAPGDKPAGKRNLIFMVSDGMGPTSLSMTRSFRQSRDGLPID
DILVLDKHHIGQSRTRSSSSLITDSAAGATAFSCAKKSYNGAISVLPDHSPCGTVLEAAK
AAGYMTGLVVTTRITDATPACFSSHANMRSYEDLIAEHQIGEYPLGRQVDLIIGGGRCHF
LPNTTSGSCRGDARDIVQLAKSKGFSYIDDREGFDGLKMGSAAQLPLLGLIAEKNVPFEI
DRRFQNDIYPSLEEMTRTALKALSDATRDSDKGFFIMIEGSRIDHAGHGNDPAAQVHEVL
AYDRAFAAVLEFLEKDSTPGVLVSTSDHETGGLSAARQLHESYPDYKWFPGVLENATHSS
EYLETKLYNYLDDEGKSVPKEEQRAYVRRQFVEKGLGIFDAKNSEIDQLLQAGDPVPAAY
VFADMISRRAQIGWSTHGHSAADVNIYASSPEDALDLVGNHENTEVGDFLAKYLDLDLDA
ITQKLKETQTSPKAATHDYAWMGEPLADDVVVDELDTYHGDFKKRSLSGRSVNYIGSGGC
GCGAVH
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggaacgatcccttgctagtaccctccgaccactcgccggaacgaagcgatgcc
gaagaagatgccctcctcaccggtcagcggactcatcgaagcgagcgtcgccgtggtcca
tcattctggcgtgaagttggattgttctcttgggctttaatagccactgcagccgttatc
atcctcgcagtcgtgtaccagcatcagcagtcgaccggtagacgtgaaggaagcttggcc
cccggcgataagccggcaggaaaacggaatcttattttcatggtctctgatggaatgggc
cctacgagtttgtcgatgacacggagcttccggcaatcgcgggatggccttcccatcgac
gatattctcgttttggataagcatcatatcggacagtctcgaacaagatcatcgtctagc
ttgattacggactctgcggcgggcgcgacggcattttcttgtgcgaagaagagttataac
ggtgctatctctgtgctgcccgaccatagcccatgcgggaccgtcctagaggcagcgaag
gcggctgggtatatgacagggttggtggttacaacaagaattacagatgccacccccgcc
tgcttttcttcccatgccaacatgcgctcgtatgaggacttgattgcagagcaccaaatc
ggagaatacccgctgggacgccaggttgatcttatcattgggggaggcagatgccatttc
cttccaaacactacttctggcagctgtcgtggtgacgccagagatattgtgcagcttgcc
aaatctaaaggtttttcatatattgatgaccgtgaagggttcgatggacttaaaatgggc
agtgcggcccagcttccattacttggccttatcgcggaaaagaatgtgccattcgaaatt
gaccgtcgatttcaaaacgacatatatccttctctggaagaaatgactcgcacggccttg
aaagccttaagcgatgccacacgcgatagcgacaagggcttctttattatgattgaaggt
tcgcgtattgaccatgctggccatggcaatgatcctgccgcccaggtccatgaagtccta
gcttatgatagagcttttgctgctgtcctggaattccttgaaaaagactctactcccggt
gtgcttgttagcacatcggatcacgagaccggaggcctatcggcggcccggcagcttcat
gagtcgtatcctgactacaaatggttcccaggtgtccttgagaatgccacgcattcctct
gagtacttagagaccaagctctataactaccttgatgacgaaggaaaatccgtgcccaag
gaggagcagcgtgcgtacgtacgtcgacaattcgtggagaagggacttggaatatttgat
gcgaaaaattccgaaatcgaccaactcctccaggccggcgacccggtgccggccgcgtat
gttttcgctgacatgatcagccgaagagcccagataggatggtcaactcatggacattcc
gctgcggatgtgaatatctacgcctcttccccagaagacgccttggatcttgtcggtaat
cacgaaaacaccgaagttggcgacttcttagctaaatatctcgacttggatcttgatgca
atcacccaaaaactcaaggagactcaaactagtccaaaagctgccacccatgattacgcc
tggatgggcgaaccattagctgatgatgtcgtcgtcgatgaactcgacacctaccatggc
gacttcaagaaacgtagtctctctgggaggagcgtcaattatatcggcagtggaggatgt
ggttgcggagcggtgcattga

DBGET integrated database retrieval system