KEGG   Corynebacterium pseudotuberculosis I19: CpI19_0047Help
Entry
CpI19_0047        CDS       T01878                                 

Gene name
malL
Definition
(GenBank) Oligo-1,6-glucosidase 1
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cpx  Corynebacterium pseudotuberculosis I19
Pathway
cpx00500  Starch and sucrose metabolism
cpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CpI19_0047 (malL)
Enzymes [BR:cpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CpI19_0047 (malL)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CpI19_0047 (malL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ADO25343
LinkDB All DBs
Position
complement(46159..47757)
Genome map
AA seq 532 aa AA seqDB search
MFNPRNGLPVPPAWLETAIFYEIYPQSFYDSNGDGIGDIQGIVDKLDYIADLGANALWIN
PCFDSPFKDAGYDVRDYYTVAPRYGTNADLEKLFTEAHNRGIKVLLDLVPGHTSEQNDWF
QYSCKAEPNQYSDRYIWTSHAFDNGDGLPFIGGEAPRNGTYILNFFKSQPALNYGFNKKT
RPWQQSVDAPGPVANQEEMANIMRYWLDKGADGFRVDMADSLVKFDGEDKQETIKVWQKI
FARFRNDYPEAAFVSEWGKPIQALKAGFDMDFYLDWRNNGYNILARNTDDPLGRSEDLSF
FKQVSGTSPQEFIDQYWPQYEQIRDLGYFSLISCNHDTPRLAPRLNDAERRLFFMFLLTM
PGVPFIYYGDEIGMRYLDIPTKEGGYQRTGTRTPMQWDAAKKNYGFSSAQTEELYLPQDT
AADAPDAASQMLDPAALRPFIQKLIGLRSQHPELHADSDFSFLWAHDNSRILAYRRESSD
GKRCAVALNAGDTADSITLESPATIIVSSGDARVEDNTVHLGPSSGVVVELA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaccctcgaaacggacttcccgttcctcctgcatggcttgaaacggcgatcttt
tatgagatctatccgcaaagtttctacgattctaacggtgatggaatcggcgacatacag
gggatcgtcgacaagcttgattacatagccgaccttggcgcaaacgcgttatggatcaac
ccttgcttcgattccccctttaaggacgcaggatacgacgtccgcgattactacacagtg
gcaccgcgctacggcactaatgctgacctagaaaagctattcacggaagcccacaacaga
gggatcaaagttctactcgaccttgtccccggacacaccagtgagcagaacgactggttc
cagtattcctgtaaagcagaacccaaccagtattcggatcgctacatctggacatctcac
gcctttgataacggcgacggccttcccttcatcggaggcgaggcaccccgcaatggcacc
tatatcctcaattttttcaagagccaaccggcactcaactatggctttaacaagaaaaca
cgcccctggcagcaaagcgttgatgcccctggtccggtagctaaccaagaagagatggcc
aacatcatgcgctactggttggacaaaggcgcggacggtttccgagtagacatggccgat
tccttggtcaaatttgatggtgaagataaacaagaaaccatcaaggtgtggcagaaaatc
tttgcgagattccgcaatgactaccctgaggcggcatttgtctcagaatggggcaagcct
attcaggcgcttaaggccggctttgacatggacttttacctagattggcgcaacaacggc
tataacatcttggcccgcaacacagacgatccgctagggcgcagcgaagacctcagcttt
ttcaagcaggtgtccggaacctcgccacaggagttcatcgaccaatactggccgcaatat
gagcagatccgcgatcttgggtacttcagcctaatctcttgcaatcatgacaccccgcgt
cttgcgcctcggctcaacgatgccgagcgccgcctgttcttcatgtttctactcaccatg
cccggcgtcccattcatctactatggcgatgaaattggcatgcgctacctcgatatccca
actaaagagggcggataccaacgcactggtacccgcacgccaatgcagtgggatgcggcg
aagaaaaactacgggttctccagcgcacaaacagaggagctatatcttccacaagacaca
gccgctgatgccccggatgcggcctcgcaaatgctggatcccgcggcgttacgccccttc
atacaaaagctcatcgggctgcggtcgcaacatccagagctgcacgcagacagcgacttc
tcattcctgtgggcacacgataactcccgaatcctcgcttatcgcagagaatcctcagac
ggaaagcgctgtgcagtagcccttaatgccggcgacaccgcagatagcatcactctagag
tccccggcgaccatcatcgtgagctccggcgacgcccgagtggaggacaacaccgtgcac
ttggggccgtcatcgggagtagtggtggaattagcttaa

DBGET integrated database retrieval system