KEGG   Lachnoclostridium phytofermentans: Cphy_1057Help
Entry
Cphy_1057         CDS       T00619                                 

Definition
(GenBank) ABC transporter related
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
cpy  Lachnoclostridium phytofermentans
Brite
KEGG Orthology (KO) [BR:cpy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpy02000]
    Cphy_1057
Transporters [BR:cpy02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    Cphy_1057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_23 SMC_N AAA_30 AAA_27 SRP54
Motif
Other DBs
NCBI-ProteinID: ABX41437
UniProt: A9KMJ2
LinkDB All DBs
Position
1331318..1332256
Genome map
AA seq 312 aa AA seqDB search
MSLQVQNLMKKYGDKVVVEDLSFEITKPGVYALLGTNGAGKTTSLRIILGMLAHDGGKVL
WNGAPLDPVKANVGYLAEERGLYPKYSLLDQLLYFAKLKNVPKKTAMDRIKYWSDRLQVN
EYVFPPKMKGKKSKANRADQLSKGNQQKIQLMAALISDPKLIILDEPLSGLDPVNTDLFK
SIIREQIAQDKYLIMSSHQMPTIEEFCSDITILNRGKAVLQGDLNEIKKSYGRVNLFVKS
DVDIASYIEEFGLRIVNKTPSEYHLKVKNEQQAMDFLAKLIGEKIPVVKFELREPSLHEI
FIEKVGDVHEEK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttacaagtacaaaatttaatgaaaaagtatggagacaaggtagttgtcgaagat
ttgagttttgagattacaaaaccaggagtgtatgctctattaggtacgaatggtgcaggt
aaaacaacctccctacgtattatccttggtatgttagctcatgacggtggcaaagtactt
tggaatggagcgccacttgacccagtgaaggcaaacgttggataccttgcagaggaacgt
ggtttatatccgaaatactcattacttgaccagttattgtattttgcaaaactaaagaat
gtgcctaagaaaacagcaatggatcgaatcaagtattggtcggaccgtttacaagtgaat
gaatatgtatttccacctaagatgaaagggaagaaatccaaagcaaatagagcagatcaa
ttatcaaaaggtaatcaacaaaaaatccagctgatggctgcgttaatttcagatcctaag
ttaatcattttagatgagccattaagtggtttggatccagttaatacagatttattcaaa
tctattattcgtgagcagatagctcaggataaatatttaattatgtcaagtcaccagatg
cctacgattgaagaattctgtagcgacattaccatcttaaatcgtggtaaggcagtgttg
caaggagatcttaatgaaattaaaaagagttatggtagagttaatctatttgtaaagagt
gatgtggatatcgcttcctacatcgaagagtttggattaagaattgtgaataaaacacca
agtgaatatcacttaaaagttaaaaacgagcaacaggcaatggattttcttgcaaaactt
atcggagagaagattccggttgtaaaattcgagctgcgcgagccatcgctgcatgaaata
ttcatagaaaaggtgggagatgttcatgaagaaaagtaa

DBGET integrated database retrieval system