KEGG   Lachnoclostridium phytofermentans: Cphy_1729Help
Entry
Cphy_1729         CDS       T00619                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
cpy03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cpy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Cphy_1729
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cpy03400]
    Cphy_1729
Enzymes [BR:cpy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Cphy_1729
DNA repair and recombination proteins [BR:cpy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Cphy_1729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ABX42101
UniProt: A9KS69
LinkDB All DBs
Position
2128734..2131175
Genome map
AA seq 813 aa AA seqDB search
MTTKLNEYNQKRNFERTLEPEGKTEDSEESLRFVIQHHMARKEHYDFRLEWNEVLLSWAV
PKGPSFDTHDKRLAVQVEDHPLEYRNFEGTIPKGEYGGGVVMLWDEGFWEPQGNVEEGLR
EGMLKFVLKGKRLKGKWALVRLKAKASEAKDNWLLLKEKDEYVKNTDGISEFITSIRTGR
TMKEIEEGEEEKIMRNPFHMVDAQLAKLVNTVPEGEDWLYELKYDGYRIIAFVEGNSVRL
ITRNGNDYMRRFHDVATSLIDLAAGRAMVLDGEMVVTDPSGKTDFQALQNYMKNPKGQNL
TYIVFDLLALNGADLRGQPLIHRKEMLEALMKDAPKNLYYSRYVRGNGKESFAVACASDM
EGIVGKKADSIYSGTRNGDWIKLKCDKRQEFVIGGYTLSDKKVWGISSLLLGVYEGEELV
FAGRAGTGLSESDMKTLEEKFENIKRMAPVFKTAPSPKSNEKITWLEPKLVAEIKFAEWT
KDNLLRQASFKGIRTDKDPMDIKREKPEEEIQSQSSEKEVEKPMGVNANSIIIEGIKISN
PDKVMFDDPVITKLDVVQYYEKVSELMLPYVSHRVLSIVRCPKGVSQTCFYKKHPGAGSK
GIITIPITTSSGETEDYFYIENISGLISEVQMGTLEFHTWGSRIDELEKPDVMVFDLDPD
EGMDLSQVRQGVLDVRSILNELCLNSYLKTSGGKGYHVVVPLKPVVNWNVFNDFARRVAE
VMEKKWPDRYTSNVRKAKRTDKIFIDWIRNGRGATSVAPYSVRARKGARVSMPIAWEELD
TVAPDGITMADALLRLNGKDPWKDFFQNNQMLK
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgactacaaaactaaatgagtacaaccaaaaaaggaactttgaaagaaccttagagccg
gaaggaaaaacagaagattctgaagaaagtctaagatttgtcatccagcaccatatggcc
cgtaaagagcactatgattttcgactggaatggaatgaagttcttttgagttgggcagta
cctaagggaccatcttttgatacacatgataagaggctcgccgtacaggtggaagaccat
cctctggaatataggaactttgagggaactattccaaaaggggagtacggcggtggagta
gtcatgctctgggatgaaggcttttgggaacctcaaggaaatgtcgaggaaggactccgt
gaaggcatgctgaaatttgttctgaaaggaaagcggcttaagggaaagtgggccttggtc
cggctgaaagcaaaggccagtgaagcaaaggataactggcttttactgaaagaaaaagat
gagtatgttaaaaatacggatgggatatccgaatttatcaccagtatcagaactggacgc
accatgaaggaaatcgaagaaggggaagaagaaaaaatcatgagaaaccccttccatatg
gtggatgctcagctcgccaaattagttaatacggtccctgagggtgaggactggctctat
gagttgaaatatgatggctatcgaattattgcgtttgtggaaggaaacagtgtacgtcta
atcaccagaaatggtaatgactatatgaggcggtttcatgatgttgccacttcgcttatt
gaccttgctgctggaagggcgatggtactggatggagaaatggtagttacagacccatcg
ggcaaaacagatttccaggctctgcaaaactatatgaagaatcccaagggccaaaatcta
acgtatattgtttttgatcttcttgcacttaatggtgcggatcttcgaggacaacctttg
attcatagaaaagaaatgcttgaagctttgatgaaggatgcccctaaaaacctctactat
agtcgatatgttagagggaacggaaaggaaagctttgcggtagcctgtgcgtcagatatg
gaaggaatcgtaggtaaaaaagccgattccatctacagcggaaccaggaatggtgactgg
attaaactcaaatgtgataaaagacaggaatttgtcattggaggatatacactttccgac
aaaaaggtatggggaataagttctcttctccttggcgtctatgaaggtgaggaattggtc
tttgccggacgtgccggtactgggctaagtgagtctgatatgaaaactcttgaggaaaaa
tttgagaacataaagaggatggccccggtttttaaaactgcacctagtcctaagtctaat
gaaaagattacatggcttgagccaaagctggttgcggaaatcaaatttgctgaatggacg
aaagacaatctattaagacaggcaagctttaaaggtatacgaacagataaggatcctatg
gatataaaaagggaaaagccggaggaggaaatacagtcccaatcctctgaaaaagaagtg
gagaaaccaatgggagtaaatgcaaacagtattattatcgaaggaattaaaatttccaat
ccggataaagtgatgtttgatgaccctgtaatcacaaagttagatgtggttcagtattat
gaaaaggtttcggagcttatgctgccgtatgtgagtcacagggttctcagcattgtacgc
tgtcccaaaggagtttcacagacatgcttttataagaagcatcccggtgcgggaagcaaa
gggattattacaattcccattactaccagcagtggggagacagaagattacttctatatt
gagaatatttcagggcttatctctgaagtgcagatgggtacactagaatttcatacctgg
ggaagccgtatcgatgagcttgaaaagcctgatgtgatggtatttgatttggatccggat
gaaggaatggatctaagccaggtccgccagggagtactggatgttagaagtattcttaac
gaactttgtttgaactcgtatctcaagaccagtggcggcaaaggatatcatgtagtagtc
cctttaaaaccggttgttaattggaatgtgtttaacgattttgcaaggcgggttgccgaa
gttatggagaagaagtggcctgacagatacacaagtaatgtcagaaaggctaagcgtaca
gataagatatttattgattggattcgaaatggtagaggcgctacaagtgtcgctccctat
tccgtaagggcgaggaaaggtgcaagggtttccatgcctattgcatgggaggaacttgac
acagttgctcccgacggcatcactatggcggatgcacttttgaggttaaacggcaaagac
ccttggaaagattttttccagaataatcagatgcttaaataa

DBGET integrated database retrieval system