KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_1203Help
Entry
CpPAT10_1203      CDS       T01879                                 

Gene name
ppgk
Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Pathway
cpz00010  Glycolysis / Gluconeogenesis
cpz00520  Amino sugar and nucleotide sugar metabolism
cpz01100  Metabolic pathways
cpz01110  Biosynthesis of secondary metabolites
cpz01120  Microbial metabolism in diverse environments
cpz01130  Biosynthesis of antibiotics
cpz01200  Carbon metabolism
Module
cpz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpPAT10_1203 (ppgk)
   00520 Amino sugar and nucleotide sugar metabolism
    CpPAT10_1203 (ppgk)
Enzymes [BR:cpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CpPAT10_1203 (ppgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEK92543
LinkDB All DBs
Position
1316929..1317681
Genome map
AA seq 250 aa AA seqDB search
MTRIGFGIDVGGSGIKGARVDLDTGDFVGDRIKILTPKPATPEAVAQTISRIVAEAEWEG
PVGITLPSVIRNQVALSAANIDQSWINVDVQKLFTKTLGGRNIAVLNDADAAGIAEVAFG
EDQARRGSAILLTLGTGIGSAFFINGVLFPNTELGHMIVEGKEAEHLASSAAKDRDELSY
SKWAKRVSKVLSEYERLFWPDVFIVGGGISRKADKWVPKLTIDTPVIPAKLRNTAGIVGA
AMAADQNIRP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacacgaattggctttggcattgatgttggcggatctgggattaaaggtgcccgcgtt
gatctggataccggtgattttgtcggagatcggatcaaaattttaacccccaagcctgcc
acccccgaagcggtcgcccaaacgatttctcgcattgttgcagaggccgaatgggaagga
cccgtcggaataacgctgccttccgtaatccggaatcaagtagcactttctgccgccaac
attgaccaatcatggatcaatgttgatgttcaaaaattatttaccaagaccctgggcggg
cgtaacatcgcagtgcttaacgacgccgatgcggcgggcatcgccgaggtagccttcgga
gaagatcaagctcgacgtggttccgccattttgctcactctaggcactgggatcggttcc
gctttctttatcaacggggtcttattccccaacaccgagttagggcacatgatcgtagag
ggaaaggaagccgagcatctagcttcatctgcagcaaaagatcgcgatgagttgagctat
tccaaatgggccaagcgcgtttctaaagtcctcagcgaatacgaacgacttttttggcca
gacgtttttatcgtaggcggtggtatctcacgcaaagctgataaatgggtacccaaactc
actatcgatacgcccgtcatacctgcaaaactacgtaataccgcaggtatcgtaggagca
gcaatggcggcagaccaaaatatcaggccttag

DBGET integrated database retrieval system