KEGG   Chenopodium quinoa (quinoa): 110682443Help
Entry
110682443         CDS       T05764                                 

Definition
(RefSeq) probable amino-acid acetyltransferase NAGS2, chloroplastic isoform X1
  KO
K14682  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00220  Arginine biosynthesis
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
cqi01210  2-Oxocarboxylic acid metabolism
cqi01230  Biosynthesis of amino acids
Module
cqi_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    110682443
Enzymes [BR:cqi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     110682443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 FR47 Acetyltransf_9
Motif
Other DBs
NCBI-GeneID: 110682443
NCBI-ProteinID: XP_021714478
LinkDB All DBs
Position
Unknown
AA seq 623 aa AA seqDB search
MLPSLFITQNSHHNLSVTTAMIKNQVKASAGVVKLKVEKNTSIMPTLLKMGFPSPGRRCC
CCCCGNALLKITSRSNTINHHQPHLTNMSSEKGVINEEGGQNKRFVKMMREAWPYLEVHR
GSTFVVVVSAFIVSSPNLLHSILQDISLLHGLGIKFVIVPGTHVHIDKLLAERGSKARYV
GPYRITDSDSLEAAMEAAGRIRIMIEAKLAAGPSLCNIRRHGENSRWHDVGVSVASGNFL
AAKRRGVVKGIDYEATGEVKKVDVARIRERLDAGCIVQLSNLGYSSSGEVLNCNTYEVAT
ACALALNAEKLICVIDGPILDDFGHLIRYLSLHDADKLIRQRAKQSEVAANYVEAVSQED
LKTQEQYQLTDTIPSLLNVNGNATFQNGLGFDNGNGLWFGEQGFAIGGQERLSRLNGYLS
ELAAAAFVCKGGVQRVHLLDGTIGGVLLLELFQRDGVGTMVASDVYEGTRMAREADLAGI
RQILRPLEESGTLIRRTDEELLAAIESFIVVEREGQIIACSALYPFVEDKCGEVAAIAVS
PECRVQGQGDKLLDYIEKKASSLGLEMLFLLTTRTADWFVRRGFSECTIDFLPEERRKRI
NLSRNSKYYMKRLVPDKSGIAVM
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgttaccaagtctttttatcactcaaaactctcaccataatttaagtgtaacaacagct
atgattaagaaccaggtaaaagcttcagcaggagtagttaagttgaaggtggagaagaac
acttcaatcatgcctacactacttaaaatgggcttcccctcaccaggccggcgttgttgt
tgttgttgctgtggtaatgctcttctcaaaattactagcaggagcaatactatcaatcat
catcaaccccatttaactaatatgagttcagagaaaggagttattaatgaggaaggtggg
cagaataagcggtttgtgaagatgatgagggaagcttggccatacttggaagtacatagg
ggttctacgtttgttgttgtcgtctctgccttcattgttagttccccaaatctcctccac
tctatcctccaggacatttcgttactccatggattagggatcaaatttgtgattgttcct
ggtacccatgtgcacattgataagcttttagcagagagaggaagcaaggctcggtatgtt
gggccatatagaatcacagattctgattcccttgaagcagctatggaagcagctggaaga
atacgtataatgatagaagcaaaacttgctgctggaccatctttatgtaatatacgcaga
catggggaaaatagccgatggcatgatgttggtgtaagtgttgcaagtggaaactttttg
gcagctaagagaagaggagttgtgaagggtattgattatgaggcaactggagaagtcaag
aaagtagatgttgctcgtattcgtgagaggcttgatgcagggtgcatagtgcaactgagt
aatttgggttattccagctctggagaagtactaaattgcaatacatatgaggtcgcaact
gcttgtgccctggctctcaatgccgagaaacttatttgtgtgattgatgggcctattttg
gatgactttggacatcttatccgctacctcagccttcatgatgcagacaagcttattcgt
caacgagctaaacaaagtgaggttgctgctaattatgtggaagctgttagtcaggaagat
ctcaaaactcaggagcagtatcagctcactgataccatcccatctctgttgaatgtaaat
ggaaatgcaacatttcaaaatggtcttggttttgacaatggaaatgggttatggtttggc
gagcagggttttgctattggtggtcaagagaggctaagtaggcttaatggttacctttca
gaattggctgctgcagcttttgtatgcaaaggtggtgtccaaagagttcatctattggat
gggacgattggtggagtccttttgttagaattgtttcagagagatggtgtggggacaatg
gtagcaagtgacgtgtatgagggaacccgaatggctagggaggccgaccttgctggaata
agacagatactccgacctttagaggagtctggcactttaatccgacggactgatgaagag
ttacttgcagcaattgagtctttcattgttgtggaaagagaaggtcagattattgcttgt
tctgctttatatccattcgttgaagataaatgtggggaagttgctgccatcgctgtatct
ccagaatgccgagtacaagggcagggtgataagttactagattatattgagaaaaaagca
tcgtcccttggattagaaatgctttttctactaaccactcgcactgcagattggtttgta
agacgtggattttcagagtgcaccattgatttcttaccggaagaaagaaggaaaaggatc
aatttatcccgcaactccaagtattacatgaaaaggctggttccagacaagagtgggata
gctgttatgtga

DBGET integrated database retrieval system