KEGG   Chenopodium quinoa (quinoa): 110686509Help
Entry
110686509         CDS       T05764                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH] 1, chloroplastic-like
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00061  Fatty acid biosynthesis
cqi00780  Biotin metabolism
cqi01100  Metabolic pathways
cqi01212  Fatty acid metabolism
Module
cqi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    110686509
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    110686509
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    110686509
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cqi01004]
    110686509
Enzymes [BR:cqi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     110686509
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     110686509
Lipid biosynthesis proteins [BR:cqi01004]
 Fatty acid synthase
  Component type
   110686509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 110686509
NCBI-ProteinID: XP_021718821
LinkDB All DBs
Position
Unknown
AA seq 400 aa AA seqDB search
MSASTASGLQMAAVRPCVSSPRRVFGATAAFCIAGFSRASWAKLTSACHISSVQSFQRNL
SSASSLKSNKGVIKAMAESSNNSAGGLPINLKGKRAFIAGVADDNGYGWAIAKSLAAAGA
EILVGTWVPALNIFETSLRRGKFDESRVLPDGSLMEITKVYPLDAVFDSPEDVPEDVKSN
KRYAGSSNWTVKEVVETVKQDFGSIDILVHSLANGPEVTKPLLETSRNGYLAAISASSYS
YVSLLKHFLPIMNPGGSSLSLTYIASERIIPGTSSYFLHIYGGGMSSAKAALESDTKVMA
FEAGRKRRIRVNTISAGPLRSRAAKAIGFIDMMIEYSIANAPLQKELSAEEVGNTAAFLA
SPLASAITGAVVYVDNGLNAMGVGVDSPIFANLDIPKDQH
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcctccacagcatcagggttgcaaatggctgcagttaggccatgtgtgtcttcc
cctcgccgtgtttttggtgccactgccgcattttgtattgctggtttcagccgagcttct
tgggctaagctcacaagtgcttgtcatatatcatctgtacagtctttccagcgcaacctt
tcatcggcgtcctccttgaaatccaacaagggtgttatcaaggcgatggcagaatctagt
aacaattctgcaggaggattgcctattaacttaaaaggtaagagggcatttattgccggt
gtagctgatgataatgggtatggttgggcaattgcaaaatctttggctgctgctggtgct
gagattcttgttggaacttgggtccctgcactgaatatatttgaaactagtctaaggcgt
ggaaaatttgatgaatcgcgagtgttgcctgatggttcattgatggagatcaccaaagta
tatcctctagatgcagtttttgacagtcctgaagatgtacctgaagatgtaaaaagcaac
aagcgttatgcaggatctagcaattggactgtgaaggaagttgttgaaacagtgaagcag
gattttggtagcattgacatcctcgtgcattcacttgccaatggacctgaggtcactaaa
cctcttttagaaacatcaagaaatggatacctggcagcaatttctgcttcaagttactct
tatgtttcgctgctcaagcatttccttcctataatgaacccaggtggttcctctctatca
ctcacatacattgcttctgagaggatcattcccgggacctcttcttatttcttgcacatt
tatggtggaggcatgagttcagcaaaagctgcattagagagtgacacaaaggtgatggca
tttgaagccgggaggaaacgcaggattagagtgaacacaatatcagctggtccacttcgg
agtcgtgctgcaaaggctattggttttatcgatatgatgatagagtattccatagctaat
gctccattgcaaaaggaattgtctgctgaggaagttggaaacactgctgctttcttggcg
tcacctttggcgtctgctattacgggtgctgttgtctatgtagacaatggtctgaatgca
atgggggtgggtgtagatagtcccattttcgcaaatcttgacattccgaaagaccagcat
tga

DBGET integrated database retrieval system