KEGG   Chenopodium quinoa (quinoa): 110686663Help
Entry
110686663         CDS       T05764                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial-like isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00010  Glycolysis / Gluconeogenesis
cqi00053  Ascorbate and aldarate metabolism
cqi00071  Fatty acid degradation
cqi00280  Valine, leucine and isoleucine degradation
cqi00310  Lysine degradation
cqi00330  Arginine and proline metabolism
cqi00340  Histidine metabolism
cqi00380  Tryptophan metabolism
cqi00410  beta-Alanine metabolism
cqi00561  Glycerolipid metabolism
cqi00620  Pyruvate metabolism
cqi00903  Limonene and pinene degradation
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110686663
   00053 Ascorbate and aldarate metabolism
    110686663
   00620 Pyruvate metabolism
    110686663
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110686663
   00561 Glycerolipid metabolism
    110686663
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110686663
   00310 Lysine degradation
    110686663
   00330 Arginine and proline metabolism
    110686663
   00340 Histidine metabolism
    110686663
   00380 Tryptophan metabolism
    110686663
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110686663
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    110686663
Enzymes [BR:cqi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110686663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 110686663
NCBI-ProteinID: XP_021718958
LinkDB All DBs
Position
Unknown
AA seq 532 aa AA seqDB search
MAARRISLLLSRSLSLSSSLSKGSSWGRNLSRYSTAAVIEDPIIPNVDIKHTQLLINGQF
VDSASGKKFPTYDPRTGNVIAHVAEGDAEDINRAVAAARKAFDEGPWPKMTAYERVRIIL
KFADLVEKHSEELAALETWDSGKPFQQAFKSELPLFVRLFRYYAGWADKIHGLTVPADGP
YHVQTLHEPIGVAGQIIPWNFPLIMFAWKVGPALACGNTIVLKTAEQTPLTALFVGKLFH
EAGLPPGVLNIVSGFGPTAGAALASHMDVDKIAFTGSTETGQTVLELAAKSNLKPATLEL
GGKSPFIVCGDADVDKAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFVEKATQRANRR
TVGDPFKSGIEQGPQIDTEQFEKVMRYIKAGTESSAKLECGGERFGSKGFFVQPTVFSNV
QEDMLIAQDEIFGPVQSILKFRDLDDVIRRANTTRYGLAAGVFTQNLDTANKLSRALKTG
TVWVNCFDVFDAAIPFGGYKMSGIGREKSVYSLNNYLQVKAVVTALKDPAWL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcgcaggatttctcttctgctttctcgttctttgtctttgtcttcttctctt
agtaaaggctcgagctggggaagaaacttaagtcgatatagcacagctgctgtaattgaa
gatcctataattcctaatgtggatattaaacatacacagcttctaatcaatggacaattt
gtggactcagcatctggaaagaaatttcctacatatgatcctcgcactgggaacgtgata
gcgcatgttgctgaaggtgatgcagaagatatcaatcgtgcagttgctgctgctcgcaaa
gcttttgatgaaggaccatggcctaaaatgacagcttatgaaagagtgcgaatcattctg
aaatttgctgatttggttgagaaacacagtgaggagcttgctgccttagagacgtgggat
agcgggaagccttttcaacaggcttttaaatcagaacttccattgtttgtccgattattt
cgctattatgctggttgggcagataaaattcatggtctgacggtacctgctgatggtcca
taccatgtacaaacattgcatgaaccaattggtgtagccgggcaaatcataccatggaac
tttcctctcatcatgtttgcttggaaagttggccctgccttggcatgtggcaacactatt
gtcttaaagactgccgagcaaactccattgactgctctctttgttgggaaactcttccac
gaggctggtcttcctcctggcgtgttgaatatagtttctggctttggtccaacagccggt
gctgcacttgcaagtcatatggatgtcgataagattgctttcacaggatctactgaaact
ggacagactgttcttgaactagcagctaagagcaaccttaagccagcaactttggagctc
ggaggaaaatctcctttcattgtatgtggggatgctgatgtcgataaagcagtagaactt
gcacattttgctctcttctttaatcagggccaatgttgctgtgctggctcccgaacttat
gtgcatgagagtgtgtatgatgaatttgtggaaaaagcaactcaacgtgccaataggcgt
actgttggagatccctttaagagtggcattgagcaaggtcctcagatagatacagagcaa
tttgagaaagttatgaggtacataaaagctggtacggagagcagtgccaaactcgagtgt
ggaggtgagagatttggatctaaaggtttctttgtccaacccactgtcttttcaaatgtt
caggaggatatgttaattgcacaggatgagatatttggcccagtacagtctatcttgaaa
ttcagggaccttgatgatgtgattcggagggcaaacaccactaggtatggcctagcagcg
ggagtattcacccagaaccttgacactgccaacaaattatcacgagcattgaaaacgggg
acagtgtgggtgaactgctttgatgttttcgatgctgcaattccttttggtgggtacaag
atgagtggtataggcagggagaagagtgtatatagcctcaacaactacctgcaggtgaaa
gctgttgtcactgctctgaaagatccagcttggttgtaa

DBGET integrated database retrieval system