KEGG   Chenopodium quinoa (quinoa): 110691234Help
Entry
110691234         CDS       T05764                                 

Definition
(RefSeq) serine/threonine-protein kinase prpf4B isoform X1
  KO
K08827  serine/threonine-protein kinase PRP4 [EC:2.7.11.1]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cqi01001]
    110691234
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cqi03041]
    110691234
Enzymes [BR:cqi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110691234
Protein kinases [BR:cqi01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   110691234
Spliceosome [BR:cqi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    110691234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pox_ser-thr_kin Kinase-like
Motif
Other DBs
NCBI-GeneID: 110691234
NCBI-ProteinID: XP_021723837
LinkDB All DBs
Position
Unknown
AA seq 1071 aa AA seqDB search
MASDSHDSHRKHSRSPSDDDSPEKSKRHKHRHHRHHRRHRHHYRHSSSKHGDAKKDEIEV
VNREEVVEEVTKPAPLVDYDDMEEGEIVDDEGVLAAEVDSFDKKVGSDVESGEFKAGDDS
YMIVGTDLENPESNHNVTRNDKSGKSKKYLKSPRSDRSGSESKEDGSHSHHDEFPLSDRV
ANGDLTRRSRKGESRSHTGHESPLQERSKEKDRIRTKSKHAFELMEVDEDDLRSRRDSFS
HKVRDDRHEARYLSPSHGRYHLETSDRSWSKSPDWKKERERSQSIAHERYSKTRHRSERD
EKLYDNGKVGYEVDDEKDSRGGKDYRSNGGEKVKDKGGERSSSYHRSSLHEGKHEDGDSK
HNETEEKMYRDKKRMEQELIKERSERERDRIRSRDHEREKDFVRDRGIHREVKSDIDWNR
DRGGSRDRDHERDRERERRREQDRGRSRDRDLGRERRRDDSTSMYKDRDAERERDKVRDR
SQKSEMDRGRDRYSGSDRHRDKARDNKDDRSSRYHKYDDRDDVYSNRDRRSDYDEAEYFK
DRKTKHDPYKDKATKDDSLMENEDALNGFLVRDDDDKDMLELKPAEPEEDDIDRIKEESR
RRREAILQKYKAKQFQQQQAVPEVSKVSDEELTKQPSLKLSSASAVQKENNGAKGDANKD
SVGDTSLNLRKSAPGNDLTAAERNTVMLGEGSPKSERSNDMFCDDIFGDSPAGVRKMGKG
DGLPLERSGLHDNWDDPEGYYSFRFGEILDGRYEITAAHGKGVFSTVVRAKDLKAGSGDP
EEVAIKIIRNNETMLKAGTEELVILKKLVGSDPDDRRHCVRYLSNFKYRNHLCIVFESLH
MNLREVLKKFGRNIGLKLTAVRTYAKQLFIALKHLRNCGVLHCDIKPDNMLVNESKNVLK
LCDFGNAMFAGKNEITPYLVSRFYRAPEIILGLPYDHPMDIWSVGCCLYELYTGKVLFPG
PSNNDMLRLHMELKGPFPKKMLRKGAFIEQHFDQDLNFLALDEDPVTKKTLRKLIVNIKP
KDVGNIIRGSSGEDPKMLANFKDLLEKIFVLDPDKRLTVSQALNHPFITGK
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgattcccatgattctcatcgcaagcacagtcgttctccctccgatgacgat
tcgccggagaaatcgaagcgccacaagcaccgccatcaccgtcaccaccgccgccatcgc
caccattaccgccatagcagctcgaagcatggagatgcgaagaaagatgaaattgaggtt
gtgaatagagaggaagtagtggaagaggtgacgaaaccagctcctcttgttgattatgat
gatatggaggaaggtgagattgttgatgatgaaggtgttcttgctgctgaagtcgattct
ttcgataagaaggtcgggtccgatgtcgaatcaggtgaatttaaggccggtgatgattct
tacatgattgttggtactgatttagaaaatcctgaaagcaatcataatgtgacgcggaat
gataaaagtgggaagtctaagaagtatttgaagtctcctagaagtgatcgaagtggtagt
gagagcaaggaagacgggagtcactctcatcatgacgaatttcctttgtcagatagggtg
gctaatggtgatcttactcgcaggtctagaaagggagaatctaggtcacatacagggcat
gagtctcctttacaagaaagaagcaaggagaaggaccgtattaggaccaaaagcaaacat
gcctttgaattaatggaggtggatgaagatgatcttagaagtagaagagattcattttct
cataaggttagggatgaccgccacgaagcaaggtatctctccccttctcatggaaggtac
catctagagactagtgataggagctggtctaaatctcctgattggaagaaagaaagagag
cgttcacagagcattgcgcacgagaggtattcaaaaacaaggcatcgcagtgaaagggat
gaaaagctgtatgataatggcaaggttggttatgaggtggatgatgaaaaggatagtcgt
ggaggtaaagattacagatctaatggtggagaaaaggttaaggataaaggaggagagaga
agttctagctatcacaggtctagtttgcatgaaggaaagcatgaagatggtgattctaag
cacaatgagacagaggagaagatgtaccgggataagaaacgaatggagcaagagctaata
aaagagaggagcgaaagggagcgtgataggatccggagcagagaccatgaacgggagaag
gattttgtgagggacagggggattcatagagaggtaaagagtgatattgactggaatcga
gatcgtggtgggagcagggacagggaccatgaaagggatagagaaagagaaaggagaagg
gagcaagatcgtggaaggagtcgggacagggatcttggcagggaaaggaggagagatgat
agcacatccatgtataaagatagagatgctgagagagaacgggataaggtaagggacagg
tctcaaaagtcggagatggataggggaagagacagatatagtggcagcgatagacataga
gataaggctagagataacaaggatgataggagcagtagataccataaatatgatgaccgt
gatgatgtatacagtaatcgagataggcgcagtgattatgatgaagcagaatatttcaag
gaccgaaagacgaagcatgatccatataaagataaggccactaaagatgattctctgatg
gaaaatgaagatgcattgaatggttttcttgtcagggatgatgatgacaaggatatgcta
gagttgaagcctgcagagcctgaagaggatgatatcgacagaatcaaggaggagagtaga
aggcgaagagaagccattcttcagaaatataaagctaaacaatttcagcagcagcaggct
gtgcctgaagtctccaaagtatcagatgaggagctgacgaagcagccttccctaaagttg
tcttctgcaagtgctgttcaaaaagaaaataatggtgctaagggtgatgctaacaaggat
tctgtaggtgatacttccttaaacttgaggaaatctgctcctggaaatgacttaacggct
gctgaaaggaatactgttatgctgggggagggttctcctaagagtgaaaggtcaaatgat
atgttctgtgatgatatatttggagattctcctgctggagttcgtaaaatgggtaaggga
gatggtctgcctcttgaaaggagtggtcttcatgataattgggatgatccagagggatat
tacagttttcgatttggtgaaatacttgatggtcgctatgaaatcacggcagcacatggt
aaaggtgtattttccactgttgttcgtgcaaaggatcttaaagctggaagtggggatcca
gaggaagtggctatcaaaataatacgaaataatgaaactatgttaaaagcagggacagaa
gagctggtgattttgaagaagctagttggctcagatcccgatgatcgccgacattgtgtt
cgttatctttcaaatttcaagtaccgtaatcatctctgtatagtttttgaatcacttcat
atgaatctgcgtgaggttctaaagaagtttggtcgtaatattggccttaagcttactgct
gtgagaacctatgcgaagcaattgtttatcgcgttgaagcatctcagaaattgcggagtt
ctacattgtgacataaaaccagataatatgctggtcaatgaatctaaaaatgtgctgaag
ctttgtgattttggaaatgcaatgttcgctggtaaaaatgaaatcacgccgtaccttgtg
agccgtttttaccgtgcacctgagattattctcggcttgccctatgaccaccccatggac
atttggtcagttggttgctgtttatatgagttgtatactggaaaggttctctttccaggc
ccctcaaacaatgatatgcttcgtcttcatatggaattgaagggtcctttcccgaagaag
atgcttcgcaagggagctttcattgagcaacattttgaccaggatttaaattttcttgcg
ttagatgaagatcctgtcactaagaagactcttaggaagctgattgttaatattaagcca
aaagatgttggtaacatcattaggggttcttctggtgaagatccaaaaatgttagccaac
ttcaaggatctgctggaaaaaatatttgtcctagatccagataaaaggctaactgtttca
caagctttgaatcacccatttattacgggcaagtga

DBGET integrated database retrieval system