KEGG   Chenopodium quinoa (quinoa): 110697125Help
Entry
110697125         CDS       T05764                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00040  Pentose and glucuronate interconversions
cqi00051  Fructose and mannose metabolism
cqi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110697125
   00051 Fructose and mannose metabolism
    110697125
Enzymes [BR:cqi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     110697125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 AlaDh_PNT_C Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 110697125
NCBI-ProteinID: XP_021730162
LinkDB All DBs
Position
Unknown
AA seq 360 aa AA seqDB search
MGKGGNSEKDGEQNMAAWLTGINTLKIQPFQLPPLGPYDVRIKMKAVGICGSDVHYLKTL
RCADFIVKEPMVIGHECAGIIEEVGSDVKTLVPGDRVALEPGISCWRCNVCKDGRYNLCP
EMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGIHACRRANVGPETT
ALIMGAGPIGLVTLLAARAFGAPRIVIVDVDEYRLSVAKKLGADETVKVSTNMQDIPEEV
EQIRKAMGRSVDVTLDCAGFNKTLSTALRATGEGGKVCLIGMGHGEMNVPLTAAAVREVD
VVGVFRYKNTWPLCIDFLTSGKIDVKPLITHRFGFSQKEVEEAFETSARGGDAIKVMFNL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagggaggaaactctgaaaaagatggagagcagaacatggctgcttggttaact
gggattaatactctcaaaattcaaccatttcagctccctcctcttggaccatatgatgta
agaatcaagatgaaggctgttggtatttgtggaagtgatgttcactatctcaagacttta
agatgtgctgatttcatagttaaagagcctatggtaattggacatgaatgtgctgggata
attgaagaagttggaagtgatgttaaaacattggtgcccggcgatcgagtggctttggag
cctgggatcagttgttggcgttgtaatgtctgcaaagacggccgctacaatctgtgccct
gagatgaagttctttgcaactcctcctgttcatggctctcttgcaaatcaggtggtacat
cctgctgatttatgcttcaaactcccagataatgttagtttggaagaaggggctatgtgt
gagccgctaagtgttggtatccatgcttgtcgtcgtgccaatgttggtcctgagaccacg
gcattgatcatgggagctggacctatcgggcttgtgacattgctagcagctcgtgctttt
ggagctccaagaatagtcatagtggatgtagatgaataccgcttatctgttgcaaagaaa
cttggtgcagatgaaactgtcaaggtttcaaccaatatgcaggacataccagaagaagtt
gagcagattcgtaaagctatggggagaagcgtagatgtgactttggactgtgcagggttc
aacaagaccttgtcaactgctcttcgtgcaacaggtgaaggtggtaaagtgtgcctaatt
gggatgggccatggtgagatgaatgttcctctcaccgctgcagctgtgagggaagtagat
gttgtgggtgtattccgttacaaaaatacttggcctctatgcattgactttcttactagt
ggtaaaatcgatgtgaagcctctcattactcacaggttcgggttctcacaaaaagaggta
gaagaagcttttgagaccagtgcccgcggtggtgatgcgattaaggttatgtttaattta
taa

DBGET integrated database retrieval system