KEGG   Chenopodium quinoa (quinoa): 110698630Help
Entry
110698630         CDS       T05764                                 

Definition
(RefSeq) formamidopyrimidine-DNA glycosylase-like isoform X1
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    110698630
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqi03400]
    110698630
Enzymes [BR:cqi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     110698630
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     110698630
DNA repair and recombination proteins [BR:cqi03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     110698630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: H2TH Fapy_DNA_glyco FbpA DpnD-PcfM BUD22
Motif
Other DBs
NCBI-GeneID: 110698630
NCBI-ProteinID: XP_021731791
LinkDB All DBs
Position
Unknown
AA seq 443 aa AA seqDB search
MPELPEVEAARSAVAENCIGKKIVKSIIADDSKVINGVSHSDFEAAILNKTIVAAHRKGK
NMWLQLDSPPFPSFQFGMAGAVYIKGVAITKYKRSSVSDADEWPSKYSKFFVELNDGLEM
SFTDKRRFATVRLLDNPASVPPISALGPDALLEPMTEGEFIQSLSKKKIAIKPLLLDQSF
ISGIGNWVADEVLYQARIHPSQNASSLSKEEGIRLLKSIKEVLEKAVEVGADSSQYPSDW
IFHSREKKPGKAFVDGKKIDFITVRGRTSAYVPELQKLTGVQATEASAKPRKRGSKKNKD
DDDDDDANDVNGDGREEEMENMKSKQMKNSKSGKQPPRRKKSAKNDDDDDGGGDDDGDDD
DDDDESDDKTKGTHDDRAAAKRKPQGINESQDVNKNKKSRGGGKKATAESKSRESIDSDV
SDDDVHDDNDKKPTKAGAKKPQK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcttcccgaggttgaagcagcgaggtccgccgttgctgagaactgcatcggt
aagaaaatagtgaaatcaatcatagcagatgattccaaggtaattaatggagtctcgcat
tccgatttcgaagctgctattcttaacaaaaccattgttgctgctcatcgtaagggcaag
aacatgtggcttcagcttgattcccctccttttccttcattccaatttgggatggcaggt
gctgtatatattaagggcgtggcaattaccaaatataaaagatcttctgtaagtgatgct
gatgaatggccctcaaaatattccaagttcttcgtagaattaaatgatggtctggagatg
tctttcacagacaagaggagatttgctacagttcgcttgctggataatccagcttcagtt
ccaccaatatctgcgctcggtccagatgctttgttggaacccatgactgaaggggagttc
attcaatccttgagcaaaaagaagattgctattaagcctttattgctcgatcagagtttt
atttctggcatcgggaattgggttgcagatgaagttctatatcaagcaagaattcatcct
tcacaaaatgcctcttccctatcaaaagaggagggtatcagactgctgaagagcataaag
gaggtacttgagaaggctgttgaggttggggctgatagtagccaatatccaagtgattgg
atttttcattcacgggaaaagaagcctggaaaggcttttgtcgatggaaagaaaattgac
ttcatcactgtacgcggaaggacttcagcttatgttccggaacttcaaaagctaactgga
gtgcaagccacagaagcttctgctaaaccacgtaagcgaggctctaaaaagaacaaggac
gacgatgatgatgatgatgcaaatgatgttaatggggatggtagggaagaggaaatggag
aatatgaaatctaagcaaatgaagaatagcaaaagtggaaagcagccacctagaaggaag
aaatccgctaaaaatgatgatgatgatgatggtggtggtgatgatgatggtgatgatgat
gatgatgatgatgagagtgatgataagacaaaaggaactcatgatgacagggctgctgca
aagaggaaaccacaaggaattaatgaaagtcaagatgttaacaagaacaagaaatccagg
ggtgggggaaagaaggctacagctgagtcgaagtctagggaaagcattgattctgatgtt
agtgatgatgatgtccatgatgataatgataagaaaccaacaaaagctggagccaaaaag
ccccagaagtag

DBGET integrated database retrieval system