KEGG   Chenopodium quinoa (quinoa): 110700485Help
Entry
110700485         CDS       T05764                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK1/AtPK6-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cqi01001]
    110700485
Enzymes [BR:cqi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110700485
Protein kinases [BR:cqi01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   110700485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Pkinase_C Kdo APH RIO1 Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 110700485
NCBI-ProteinID: XP_021733724
LinkDB All DBs
Position
Unknown
AA seq 464 aa AA seqDB search
MVSNSQHTKSLHKILASKLTLSIPSSSSSPPTEDFDFSDVFGPTPSQSSSSSSSQPTYPR
DPPVIHYRTHSFLGPSPRYTPPNFHPFQKTPEEIISQITDDDDEIEVKRDEKDGTFIEQL
VCIEEERENGMVPKVGPEDFEILRLVGKGAFGKVFQVRKKGDCDDGGDGIMAMKVMRKDN
IIKKNHVDYMIAERDILTKVVHPFIVQLRYSFQTKSKLYLILDFLNGGHLFFHLYRQGIF
SEDQARLYTAEIVSAVSHLHKNGIVHRDLKPENILMDADGHIVLTDFGLAKEIDETSRTN
SMCGTMEYMAPEIIQAKGHNKNADWWSIGILLYEMLSGKPPFAHANRQKLQQKIINDKVK
LPSMVSTEAHSLLRGLLQKDPSKRLGSGPAGSDEVKSHRWFRPINWKKLEAKELKPKFKP
DVNGKECTANFDKCWTTMPADDSPASTPTGNEHFAGYTYVAPNP
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggtttctaactcacaacacaccaaatctctgcacaaaatccttgcgtcaaaattgaca
ctttcaatcccatcttcttcttcttcacctcccactgaagatttcgatttctccgatgtt
tttgggccaaccccatctcaatcttcatcttcttcttcttcccaacctacatatccgagg
gacccaccagtgattcattaccgtactcactcttttctgggtccctcacctcgatatact
ccccctaatttccacccatttcagaaaactcctgaagaaatcatatcccagatcacagat
gatgacgatgaaatcgaggtgaagagggatgagaaagatgggacttttatcgaacagttg
gtgtgcattgaggaggagagagaaaatgggatggttcctaaggtgggtcctgaagatttt
gagattttgagacttgttgggaaaggggcttttgggaaggtttttcaggttaggaagaaa
ggggattgtgatgatggtggtgatggaattatggctatgaaagttatgagaaaagataac
attataaagaagaatcatgttgattatatgattgctgagagggatattcttaccaaagtt
gttcacccttttattgttcagcttaggtactcttttcagacgaagtcaaagctttatctg
attttggattttttgaatggaggacatctgttctttcatctctacagacaggggattttc
agtgaggaccaggcaagactttacactgctgaaattgtatctgctgtatcgcatcttcac
aagaatgggattgtgcatcgagatctcaaacctgaaaatattctcatggacgctgatggg
catattgttctaactgattttggacttgcaaaagaaattgatgaaacaagcagaacgaat
tcaatgtgtggaaccatggaatatatggctccagaaatcatacaagctaaaggtcataac
aagaatgctgattggtggagtattggaatcctgttatatgaaatgctaagtggaaagcca
ccattcgcacatgccaacagacagaagctccaacagaaaatcatcaatgacaaagtgaag
cttccatcaatggtatccactgaagcacattctttgcttagaggattgttgcaaaaggat
ccttccaagaggcttggtagtgggcccgcaggatcagatgaagttaagagccacagatgg
tttcgtcctatcaattggaagaaactggaggcaaaggagttgaagcccaagttcaaacca
gatgtgaatgggaaggaatgcactgctaactttgacaaatgctggacaacaatgccagca
gatgactcaccagcctctacacccactggcaatgaacactttgcaggttatacgtatgtt
gctcccaacccatga

DBGET integrated database retrieval system