KEGG   Chenopodium quinoa (quinoa): 110703629Help
Entry
110703629         CDS       T05764                                 

Definition
(RefSeq) serine/arginine-rich splicing factor SR45a
  KO
K12897  transformer-2 protein
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110703629
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cqi01009]
    110703629
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cqi03041]
    110703629
Protein phosphatases and associated proteins [BR:cqi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110703629
Spliceosome [BR:cqi03041]
 Common components
  Common spliceosomal components
   SR proteins
    110703629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 RRM_occluded Corona_nucleoca
Motif
Other DBs
NCBI-GeneID: 110703629
NCBI-ProteinID: XP_021737111
LinkDB All DBs
Position
Unknown
AA seq 219 aa AA seqDB search
MADSQRKRYSRSPSPRKARSRSQSRSRSMSPPRYRSRSHSRSRSPSRGRVETNPGNTLFV
TGLSSRVTQRELEDFFSKEGKVSSVFLVMEPRTRISRGFAFVTMDTVEDADRCIKYLNQS
VLEGRYITVEKSRRKRPRTPTPGQYLGLGHRRKFRGGYGGRDDYDHRRSPRRSPYRGSRG
YSPRRSPYAERSRRYRSRSYSPYGSPDRGYGRRSGAYGR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggccgattctcagcgcaagaggtattcgagatctccatcacctcggaaagcaagatct
aggtctcagtccaggtctagatcaatgtctcctcctagataccggtctcgttctcattcc
aggtcaaggtcgccgagccgtggcagggttgagacgaatcctggaaatacactttttgtt
actggtctctcttctagagttactcaaagagaacttgaggattttttttccaaggaagga
aaggtaagctcagtattcttggtcatggagccacgtacacgcatatcaagaggctttgcc
tttgtgactatggacactgttgaagatgcggatcgttgtatcaagtacctcaatcaatct
gttcttgaaggtcgctacatcactgttgagaagtcaaggagaaaacgaccaaggacaccg
acacccggacagtatcttggcttaggacatcgacgtaaattccgtggtgggtatggtggc
cgtgatgactatgatcataggaggtcaccaagacgttcaccttatcgaggtagtcgaggt
tattctcctcgtcgctccccttatgctgaaaggtcaaggaggtacaggtcaaggtcctac
tctccttatggaagcccagacagaggatatgggcgtcgctctggtgcctatggcagataa

DBGET integrated database retrieval system