KEGG   Chenopodium quinoa (quinoa): 110703919Help
Entry
110703919         CDS       T05764                                 

Definition
(RefSeq) DNA ligase 6-like isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi03030  DNA replication
cqi03410  Base excision repair
cqi03420  Nucleotide excision repair
cqi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110703919
   03410 Base excision repair
    110703919
   03420 Nucleotide excision repair
    110703919
   03430 Mismatch repair
    110703919
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqi03032]
    110703919
   03400 DNA repair and recombination proteins [BR:cqi03400]
    110703919
Enzymes [BR:cqi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110703919
    6.5.1.6  DNA ligase (ATP or NAD+)
     110703919
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110703919
DNA replication proteins [BR:cqi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110703919
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110703919
DNA repair and recombination proteins [BR:cqi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110703919
   NER (nucleotide excision repair)
    Other NER factors
     110703919
   MMR (mismatch excision repair)
    Other MMR factors
     110703919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DRMBL Lactamase_B_2 UBA_4 RMMBL
Motif
Other DBs
NCBI-GeneID: 110703919
NCBI-ProteinID: XP_021737411
LinkDB All DBs
Position
Unknown
AA seq 1392 aa AA seqDB search
MSTSKTLTLNSSELFLQSQNPLPSSLPPFPANFPPSKLIPKTRFIVDGFRNSGEFSLSYF
LSHFHSDHYTGLTSTWSRGIVFCSETTARLVVKVLGVSASFVVGLPIDDTVVIDDCEVTL
IDANHCPGAVQFLFKVPVNGGKFERYVHTGDFRFCDDTKLMPKLSEFVGCDAVFLDTTYC
DPKFLFPLQEESIDYVVSVIDRIRSENRDDGKNVLFLVATYVIGKERILLEISRRCGCKI
HVDSRKMGILRALGYEDEGVFTEDESASDVHVVGWNVLGETWPYFRPNFVKMSEIMVEKD
YKKVVGFVPTGWTYEVKRNKFAVRTKDSFEIHLVPYSEHSNYNELREYVRFLKPKRVLPT
VGSDVENVDSKHAIKMQKHFAGLVDEMANKHEFLMGFYRAPQGKAKVKVDDPLTELDKGV
EHFKEEFDVSTLDYEHKIDSGSVCPVDPMDDPGSQIVASLSDKEKEEIMQELRDCLPTWV
SVDQMLELIKTYGRNIVDAVSHFYEHETEFYEQIVKLFPSSLSNLESQSTTFHNPCSVDN
SLQTLVKSPNQKAKFLPLKQSVASSVSPGKRKKNSENKKSKKGKINSNLESGGIKQSTIT
KFFSKNTSVCQGSIAGPLSGTSTEDTNLSSEHSAVCYKEELAQFIQIIDGSESMKNFAAE
LLQKAEGNVGLALDMYYNNSEAHLGGNQKSIDVNSKLLPCEVPDESLSCQGKERSETGNK
IYQSAQDSLVDNIAVNYVSLPPEKYSPIEHACWKQGQPAPYLHLARTFDIVEGEKGKIKA
TSMLSNMFRSLLVLSPEDVLPAIYLCTNKIAADHENMELNIGGSLVASALEEACGTNRAK
IRERYNNLGDLGDVAQECRQSQSLLLPPSPLLIREVYSVLQKISIQTGSGSMGRRKGLIV
GMMRSCREKEMKFLVRTLVRNLRIGAMMRTVLPALAQAVALNCYDGAGKNQKELLQGLSA
AVVEAYNILPDLNILVPSLMSKGIKFSATALAMVPGIPIRPMLAKITNGVAQALKLFQNR
AFTCEYKYDGQRAQIHKLDNGSVRIFSRKGDETTSKFPDLVHIIQDLCKPSAESFIIDAE
VVGIDRKNGNKFISFQELSARERGSKASSVSLDRIKVDICVHVFDVMLVNGEKLLPCSLR
ERRQCMNGLFRGNKPGYLEYAKELTVEADEAHPDCEATLMKINAFLEDAFQSSCEGIMVK
SLDVDAGYFASKRADTWLKVKRDYMDGVGDSLDLVPIGAWHGNGRKAGWYSPFLMACYNP
DTEEFESVCRVMSGFTDAFYKEMKEFLSGDKILIKKPLYYRTDEVPDMWFSAELVWEIRG
ADLTVSPVHKAAVGIVHPSRGISMRFPRFIRTRPDRQPEDCSTSSETAEMFHSQTRKMDG
MGGNVANLPTEN
NT seq 4179 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacctccaaaaccctaaccctaaattcctccgaactcttccttcaatcgcaaaat
cctcttccatcatctcttccaccatttcccgccaatttcccaccctcaaaactcatcccc
aaaacccgcttcatcgtcgatggtttccgaaactccggcgaattttctctctcctacttt
ctctcacactttcactccgatcactacaccggactcacttcaacttggtctcgcggcatc
gtcttttgctcggaaaccacagctcgtctcgttgttaaagttctcggtgtttcggcgtca
tttgttgttggtttaccgattgacgataccgtggttatcgatgattgtgaggtaacccta
attgatgctaatcattgtcctggtgctgttcaatttttgtttaaggttcctgttaatggt
gggaaatttgagcgttatgttcatacgggtgattttaggttttgtgatgatacgaaattg
atgcctaaattgagtgaatttgttggttgtgatgctgtttttctcgatacgacgtattgt
gaccctaaatttttgtttcctttgcaagaggaatcgattgattatgtagttagtgtgata
gataggattaggagtgagaatagggatgatgggaagaatgttttgtttcttgttgcaact
tatgttattggaaaagagaggattttgttggaaatttcgcgtaggtgtggttgtaagata
catgtagatagtaggaaaatggggattttgcgcgctttaggttatgaggatgaaggggtg
tttacggaggatgagtcggctagtgatgttcatgttgttgggtggaatgtgttgggtgag
acttggccgtattttcggcctaattttgtgaagatgagtgaaattatggttgagaaggat
tataagaaggttgtgggatttgttcctactgggtggacttatgaagtgaagagaaataag
tttgcagttaggacgaaagattcgtttgagattcatctggtgccttacagtgagcattcg
aactacaatgagcttagagaatatgtgaggtttttgaagccaaagcgtgtacttcctact
gttggctctgatgttgagaatgtggacagtaaacatgctattaaaatgcaaaagcatttt
gcaggattggtggatgagatggctaataaacatgaatttttgatgggtttttaccgtgca
cctcagggaaaagcgaaggtcaaggtagatgatccattgaccgagttggacaaaggtgta
gaacatttcaaagaggagtttgacgtgtccacattggattacgaacataaaattgactct
ggttccgtgtgtcccgtagatcctatggatgatcctggttcacaaattgtagcctctttg
agtgataaggaaaaggaggagatcatgcaagagcttcgggattgtttgcctacatgggtt
tctgtagatcagatgctagaacttatcaaaacatatggaagaaatattgttgatgcagtt
tctcatttttatgaacatgaaacagaattttatgagcagattgtcaaacttttcccttca
tcattgtcaaacttagaaagtcaatccacaacatttcataatccttgctctgttgataac
agtttgcagacactggtgaagtcacctaatcaaaaggccaagtttcttccattgaagcag
tcagttgcaagcagtgtttctcctggaaaaagaaagaaaaattctgaaaataagaagagt
aagaaagggaaaattaactcaaatcttgaatctggtggcataaaacaatctacaataacc
aagttttttagtaaaaataccagtgtttgtcagggaagcattgctggtcccctgtctggg
acaagtactgaagacacgaatttatcttctgaacattcagctgtatgttataaggaagag
ctggcacaatttattcagatcattgatggtagtgaatcaatgaaaaactttgctgctgag
ctgttacaaaaggctgaaggaaatgttggcttggcactagacatgtattacaataattct
gaagctcaccttggtggtaatcagaaaagtatagatgttaatagcaaattgctaccttgt
gaagttccggatgagagcctctcttgccaagggaaagaaaggtctgaaactggcaacaag
atctatcaatcggcacaagattcattggttgacaatattgctgttaactatgtatcactg
ccaccagagaagtattctccaatagaacatgcttgctggaagcaaggtcagcctgctcca
tatttacacttggcacggacttttgatattgttgaaggtgaaaagggaaaaattaaagct
acctctatgctttccaatatgtttagaagtttgctggttttgtctccagaggatgtccta
cctgctatttatctctgcacaaataagattgcggctgaccatgagaatatggaattaaac
atcggcgggagtttggttgcatctgctcttgaagaggcatgtggaaccaatagagctaag
attagagaaaggtacaacaatcttggtgatcttggtgatgttgcacaggaatgtcggcaa
tcacaatcactacttcttcctccttcaccccttttgatacgagaagtatattctgtactt
cagaaaattagcatacagacaggcagtggaagcatgggtaggagaaaaggccttattgta
ggtatgatgcgatcttgcagagagaaggaaatgaagtttcttgtcagaaccttggttagg
aacttaagaattggagccatgatgagaacagttcttcctgcattggctcaagcagttgct
ttgaactgttatgatggtgcaggaaaaaatcaaaaagaattgcttcagggcctttctgct
gctgttgttgaagcttataatattcttccagacttgaatatattggtgccttctcttatg
agcaaaggcataaagttttcggctactgcgctagctatggtaccaggcattcctatcagg
cccatgcttgctaaaataactaatggggttgcacaagcactgaagctattccagaataga
gctttcacgtgtgagtacaagtatgatggtcaacgtgcccaaatacacaaacttgataat
ggttctgtgcgcatcttttcaagaaagggggatgagacgacctcaaaattcccagatttg
gtgcacattattcaggatttatgtaaaccttctgcagagtcttttattatagatgcggag
gtggttggaattgatcgcaagaatggaaacaagtttatatcctttcaagaactatctgcg
agagagagaggcagtaaagcttcttcggtttcattggatagaataaaggttgacatctgt
gtccatgtgttcgatgtcatgctcgtcaatggagagaagctgttgccttgctcactcagg
gagagacggcagtgcatgaacggtctttttagagggaataagcctggttatttggaatat
gcaaaggaattaactgtggaagcagatgaagctcatccagactgtgaagccactctgatg
aagattaatgctttccttgaagatgcattccagtcttcttgtgaaggaattatggttaaa
tcactagatgttgatgctggctactttgcttcaaagcgtgcagatacatggttgaaggta
aagcgagattatatggatggtgtgggggactcccttgatttagtacccattggtgcttgg
catggcaatgggagaaaggcaggatggtatagtccatttcttatggcttgttacaatcct
gatacagaggaatttgaaagtgtatgccgtgttatgtcaggatttacggatgctttctac
aaagagatgaaagagtttctctctggagataagatcttgatcaagaagcccttgtattac
cgaacagatgaagttcctgatatgtggttttcagctgaattggtgtgggagataagaggt
gcagacctcactgtatcacctgttcacaaggctgccgtaggaatcgttcatccttcacga
ggtatttctatgaggtttccaagattcatccgtacccgtccggacagacaaccagaagat
tgcagtacctcttcagaaactgccgaaatgtttcattctcaaactcggaaaatggatggg
atggggggaaatgtcgcaaatctgccgacagagaattga

DBGET integrated database retrieval system